(data stored in ACNUC7421 zone)

EMBL: BA000007.CYOD

BA000007.CYOD        Location/Qualifiers
FT   CDS_pept        complement(513771..514100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoD"
FT                   /locus_tag="ECs_0483"
FT                   /product="cytochrome o ubiquinol oxidase subunit IV"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33906"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33906"
FT                   /db_xref="GOA:P0ABJ7"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014210"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ABJ7"
FT                   /protein_id="BAB33906.1"
FT                   /translation="MSHSTDHSGASHGSVKTYMTGFILSIILTVIPFWMVMTGAASPAV
FT                   ILGTILAMAVVQVLVHLVCFLHMNTKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNY
FT                   NMMMH"
     atgagtcatt ctaccgatca cagcggcgcg tcccatggca gcgtaaaaac ctacatgaca        60
     ggctttatcc tgtcgatcat tctgacggtg attccgttct ggatggtgat gacaggggct       120
     gcctctccgg ccgtaattct gggaacaatc ctggcaatgg cagtggtaca ggttctggtg       180
     catctggtgt gcttcctgca catgaatacc aaatcagatg aaggctggaa catgacggcg       240
     tttgtcttca ccgtgctaat catcgctatc ctagttgtag gctccatctg gattatgtgg       300
     aacctcaact acaacatgat gatgcactaa                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page