(data stored in ACNUC7421 zone)

EMBL: BA000007.DNAQ

BA000007.DNAQ        Location/Qualifiers
FT   CDS_pept        239609..240349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="ECs_0211"
FT                   /product="DNA polymerase III epsilon subunit DnaQ"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33634"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33634"
FT                   /db_xref="GOA:Q8X7Y5"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7Y5"
FT                   /protein_id="BAB33634.2"
FT                   /translation="MTAMSTAITRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRR
FT                   LTGNNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNAA
FT                   FDIGFMDYEFSLLKRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSKRT
FT                   LHGALLDAQILAEVYLAMTGGQTSMAFAMEGETQQQQGEATIQRLVRQASKLRVVFATD
FT                   EELAAHEARLDLVQKKGGSCLWRA"
     atgaccgcta tgagcactgc aattacacgc cagatcgttc tcgataccga aaccaccggt        60
     atgaaccaga ttggtgcgca ctatgaaggc cacaagatca ttgagattgg tgccgttgaa       120
     gtggtgaacc gtcgcctgac gggcaataac ttccatgttt atctcaaacc cgatcggctg       180
     gtggatccgg aagcctttgg cgtacatggt attgccgatg aatttttgct cgataagccc       240
     acgtttgccg aagtagccga tgagttcatg gactatatcc gcggcgcgga gttggtgatc       300
     cataacgcag cgttcgatat cggctttatg gactacgagt tctcgttgct taagcgcgat       360
     attccgaaga ctaatacctt ctgtaaggtc accgatagcc ttgcggtggc gaggaaaatg       420
     tttcccggta aacgcaacag cctcgatgcg ttatgtgccc gctacgaaat agataacagt       480
     aaacgaacgc tgcacggggc attactcgat gcccagatcc ttgcggaagt ttatctggcg       540
     atgaccggtg gtcaaacgtc gatggctttt gcgatggaag gagagacaca acagcaacaa       600
     ggtgaagcaa caatccagcg ccttgtacgt caggcaagta agttacgcgt tgtttttgcg       660
     acagatgaag agcttgcagc acatgaagcc cgtctcgatc tggtgcagaa aaagggcgga       720
     agctgcctct ggcgggcata a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page