(data stored in ACNUC7421 zone)

EMBL: BA000007.DSBG

BA000007.DSBG        Location/Qualifiers
FT   CDS_pept        complement(719298..720044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbG"
FT                   /locus_tag="ECs_0643"
FT                   /product="thiol:disulfide interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34066"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34066"
FT                   /db_xref="GOA:P58320"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58320"
FT                   /protein_id="BAB34066.2"
FT                   /translation="MLKKILLLALLPAIAFAEELPAPVKAIEKQGITIIKTFDAPGGMK
FT                   GYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQS
FT                   HWLLDGKKDAPVIVYVFADPFCPYCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATA
FT                   AAILASKDPAKTWQEYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYY
FT                   MSKENTLQQAVGLPDQKTLNIIMGNK"
     atgttaaaaa agatactttt actggctctg cttcctgcaa tcgccttcgc agaggaactt        60
     cctgctccag taaaagcgat tgaaaaacag ggcattacaa tcatcaaaac gttcgatgcc       120
     cccggaggaa tgaaaggtta tctcggaaag tatcaggata tgggcgtcac catctacctg       180
     actccagatg gtaagcacgc tatctctggt tacatgtaca acgagaaagg tgaaaacctg       240
     agtaacacac ttatcgaaaa agaaatttac gcaccagccg gacgcgaaat gtggcaacgg       300
     atggaacaat cccactggct cctcgacggt aaaaaagatg cgccggtcat tgtctacgtc       360
     ttcgccgatc cgttctgccc atattgtaaa cagttctggc agcaggcgcg cccgtgggta       420
     gattctggca aagtacagtt gagaacattg ttggttgggg ttatcaaacc agaaagtccg       480
     gcgacagccg cggcaattct tgcctccaaa gatcccgcaa aaacctggca agaatatgaa       540
     gcctctggtg gcaagcttaa gctaaacgtg cctgcaaacg taagtacaga gcaaatgaaa       600
     gtgttaagcg acaacgagaa actcatggac gatctggggg caaatgtcac tccggctatc       660
     tattacatga gtaaggaaaa tacgctgcaa caggccgtgg ggttgcccga tcagaaaacg       720
     cttaatatca ttatgggaaa taaataa                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page