(data stored in ACNUC7421 zone)

EMBL: BA000007.ECPC

BA000007.ECPC        Location/Qualifiers
FT   CDS_pept        complement(339216..341741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecpC"
FT                   /locus_tag="ECs_0321"
FT                   /product="ECP production outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33744"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33744"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR031917"
FT                   /db_xref="InterPro:IPR032636"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X6I4"
FT                   /protein_id="BAB33744.1"
FT                   /translation="MPLRRFSPGLKAQFAFGMVFLFVQPDASAADISAQQIGGVIIPQA
FT                   FSQALQDGMSVPLYIHLAGSQGRQDDQRIGSAFIWLDDGQLRIRKIQLEESEDNASVSE
FT                   QTRQQLMALANAPFNEALTIPLTDNAQLDLSLRQLLLQLVVKREALGTVLRSRSEDIGQ
FT                   SSVNTLSSNLSYNFGIYNNQLRNGGSNTSSYLSLNNVTALREHHVVLDGSLYGIGSGQQ
FT                   DSELYKAMYERDFAGHRFAGGTLDTWNLQSLGPMTAISAGKIYGLSWGNQASSTIFDSS
FT                   QSATPVIAFLPAAGEVHLTRDGRLLSVQNFTMGNHEVDTRGLPYGIYDVEVEVIVNGRV
FT                   ISKRTQRVNKLFSRGRGVGAPLAWQVWGGSFHMDRWSENGKKTRPAKESWLAGASTSGS
FT                   LSTLSWAATGYGYDNQAVGETRLTLPLGGAINVNLQNMLASDSSWSSIGSISATLPGGF
FT                   SSLWVNQEKTRIGNQLRRSDADNRAIGGTLNLNSLWSKLGTFSISYNDDRRYNSHYYTA
FT                   DYYQNVYSGTFGSLGLRAGIQRYNNGDSNANTGKYIALDLSLPLGNWFSAGMTHQNGYT
FT                   MANLSARKQFDEGTIRTVGANLSRAISGDTGDDKTLSGGAYAQFDARYASGTLNVNSAA
FT                   DGYVNTNLTANGSVGWQGKNIAASGRTDGNAGVIFNTGLEDDGQISAKINGRIFPLNGK
FT                   RNYLPLSPYGRYEVELQNSKNSLDSYDIVSGRKSHLTLYPGNVAVIEPEVKQMVTVSGR
FT                   IRAEDGTLLANARINNHIGRTRTDENGEFVMDVDKKYPTIDFRYSGNKTCEVALELNQA
FT                   RGAVWVGDVVCSGLSSWAAVTQTGEENES"
     atgcctttac gacggttctc cccaggactg aaagcccagt ttgccttcgg catggtcttt        60
     ttgttcgttc agcccgatgc cagcgctgct gacataagtg cgcagcaaat aggtggggtg       120
     attattccgc aggccttcag tcaggcgctt caggacggca tgagcgtccc gctctatatt       180
     catctcgccg gtagccaggg tcgccaggac gatcagcgaa tcggcagcgc ttttatctgg       240
     ttggatgatg gacagctacg catccggaaa atacagctgg aagagagtga agataacgcc       300
     agtgtcagcg aacaaactcg acagcagctg atggctctgg cgaacgcccc gttcaatgag       360
     gcccttacca tccccctgac tgacaacgcg cagctggatc tcagcttgcg ccaactgctg       420
     ctgcagctgg tggtcaagcg cgaagcgctg ggcactgtac tacgctcacg tagcgaagac       480
     atcgggcagt ccagtgttaa caccctcagc agtaatctga gctataactt cggcatctat       540
     aacaaccagt tgcgtaacgg cgggagcaac acatccagct atctgtcgct gaataacgtt       600
     actgcactgc gcgaacatca tgtggtgctc gacggctcgc tgtacgggat cggtagcggt       660
     caacaggaca gtgaattata taaagcgatg tatgaacgcg attttgccgg tcaccgattt       720
     gccggtggaa cgctcgacac ctggaacttg cagtccttag ggccgatgac cgccatttca       780
     gcagggaaga tttacggcct ttcctgggga aaccaggcca gctccaccat cttcgacagc       840
     agccagtcag ccacgccagt gatcgccttt ttaccggcgg cgggtgaagt acatctcacc       900
     cgtgatgggc ggttactaag cgttcagaac ttcaccatgg gcaatcatga agtggatacc       960
     cggggtctac catacggtat ttacgatgtg gaagttgagg tgatcgttaa cggtcgcgtg      1020
     atcagcaaac gcacccagcg ggtcaataag ctgtttagcc gggggcgcgg cgtcggtgca      1080
     ccactggcgt ggcaggtatg gggcggtagc tttcatatgg atcgctggtc ggaaaacggg      1140
     aaaaagacgc gaccagctaa agagagttgg ctggcaggtg cctcgacctc cggctcactg      1200
     agtacgctta gctgggcggc aacgggatat ggatacgata atcaggcggt gggtgaaacc      1260
     cgtctgacgc tgccgcttgg gggagcgatc aacgttaacc tgcaaaatat gctggccagt      1320
     gacagctcat ggagcagcat cggcagcatc agcgccactc taccgggagg ctttagttcg      1380
     ctgtgggtta atcaggaaaa aacccgcatt ggcaatcaat tgcgacgtag cgatgccgac      1440
     aaccgtgcta tcggcggcac actcaacctg aactcactgt ggtcgaagct gggcacattc      1500
     agcatcagct acaatgatga ccgccgttac aacagccatt attacacggc agattactat      1560
     caaaatgtct acagcggtac ctttggttcg cttggcctgc gggccggtat tcagcgctat      1620
     aacaacggcg acagcaacgc caatacaggg aaatatatcg ctctcgatct ctcgctacca      1680
     ctgggcaact ggtttagcgc agggatgact catcaaaacg gctacaccat ggcaaacctg      1740
     tcagcacgca agcagtttga tgaagggacc attcgcactg ttggtgccaa tctgtcacga      1800
     gccatctccg gcgataccgg tgatgacaaa actctcagtg gtggggcgta tgcacagttc      1860
     gacgctcgct acgccagcgg aacgctgaac gtcaatagcg cggcggacgg ctacgtcaat      1920
     accaatttaa ccgccaatgg cagcgtcggc tggcagggta aaaacattgc tgccagcggg      1980
     cggactgatg gcaacgctgg ggtgatattc aacaccgggc tggaggacga cggtcagatc      2040
     agcgccaaaa tcaacgggcg gattttcccg cttaacggca agcgtaacta tctcccgctc      2100
     tctccctatg gaagatatga ggtggagtta cagaacagca aaaactcact cgacagttac      2160
     gatatcgtca gcggtcgcaa aagtcatctg actctctatc caggcaatgt cgctgtcatt      2220
     gagccagagg tgaagcagat ggttaccgtc tccggtcgta tccgtgcgga agacggcaca      2280
     ctgctggcta acgcacggat taacaaccat atcggccgaa cccgaaccga tgaaaacggc      2340
     gagtttgtca tggacgtgga taagaaatac cccactatcg attttcgcta cagtggcaat      2400
     aaaacctgcg aagtggcact ggaactcaac caggcgcgcg gtgccgtctg ggtcggtgat      2460
     gtggtctgca gcggcctctc atcgtgggcg gcggtgacgc agacaggaga agagaatgag      2520
     agttaa                                                                 2526
//

If you have problems or comments...

PBIL Back to PBIL home page