(data stored in ACNUC7421 zone)

EMBL: BA000007.ESPX1

BA000007.ESPX1       Location/Qualifiers
FT   CDS_pept        complement(23330..24751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="espX1"
FT                   /locus_tag="ECs_0025"
FT                   /product="T3SS effector-like protein EspX"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33448"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33448"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA51"
FT                   /protein_id="BAB33448.1"
FT                   /translation="MTDGISTSPHCLYKSNIVDDVIINKTRQNELVKVFCEYKTEFLIL
FT                   FDDFFRSQDLPKPSPVLHHFFQYTHLRDAHFYRCKLIEHTVQFSFFKHKGITLLRLDVF
FT                   DDRTSECLSEEIKIYQECHEKFIKFLKANFNQEIYPELYTPEIFYEACRNLQSFYDHQE
FT                   TSQNAKYSAIVKKKSYFNKEIRNLIKKNIYPELYNEQCNKIPASSTDDNQKITWQNFKT
FT                   SNAAYSQLCEKLSLLKSSPSRLIEKSAYCSNENMITDKFDVVFSYCGDNVKEFILLLPY
FT                   NKSLEMHELNEQNIQYLTALNINIHKLLLSNITIEKSNLSYGYYFGCVLSNISCFESDL
FT                   SNTIFSNGEINNLFIKKSNIFGTSFTNTMIKNLRCEDIMPGRWTTQLVNKHLGYRYTGV
FT                   FKTLASIDDKPSRFEILIPLVQTLVRDNVKLNNDVYKELKKFMHDYDKTSPEMRKYLQS
FT                   INESMFLMKKISHQD"
     atgacagatg gtatctcaac ttcgccacat tgtctttata aatcaaatat agtagatgat        60
     gtaataataa ataaaacaag acaaaatgag ttagtaaaag tgttttgcga gtataaaaca       120
     gagttcttaa ttttgtttga tgactttttc agaagccagg atttgcctaa accatctcca       180
     gtcctccatc atttttttca atatactcat ctgagagatg cacattttta tagatgtaaa       240
     ctcatagaac atacagttca attttctttt tttaaacaca aaggcatcac attacttaga       300
     ttggatgttt ttgatgacag aacaagcgaa tgtctttctg aagagattaa gatatatcaa       360
     gaatgccatg aaaaatttat taaattttta aaggcaaact tcaatcagga aatataccca       420
     gagctataca ctcctgaaat attttatgag gcctgcagaa atctccagtc attttatgat       480
     catcaggaga cgtcacaaaa cgctaagtac agtgcaatag tcaagaaaaa aagttatttt       540
     aataaggaaa tcagaaatct aataaaaaag aatatttatc ctgagctata caatgagcaa       600
     tgcaataaaa tccccgcctc atcgacagat gataaccaga aaataacatg gcagaatttt       660
     aaaactagca atgcggcata ttcacaacta tgtgaaaaat tatctttatt aaaaagctcg       720
     cccagtcggt taatagagaa atcagcttac tgctcaaatg aaaacatgat caccgataaa       780
     tttgatgttg tcttttctta ctgcggagat aatgtaaagg aatttatact tttattaccc       840
     tataataaat cgctggagat gcatgaactt aacgagcaaa acatccagta tttgactgcc       900
     cttaatatta atatacataa actgttgcta tcaaatataa caatagaaaa gagcaacctt       960
     tcatatgggt attattttgg ttgtgtatta tccaatatat catgttttga aagcgactta      1020
     tcaaacacca tcttttcaaa tggagaaata aacaacctct tcattaaaaa aagcaacata      1080
     tttggaacat cgttcactaa taccatgata aaaaatttgc gctgtgaaga tattatgcct      1140
     ggccgatgga ccactcaact tgtcaataag cacttaggtt acagatacac aggagtattc      1200
     aaaaccctgg caagtattga tgacaaaccg tcccgtttcg aaattttgat accattggta      1260
     caaactttag ttcgcgacaa tgtaaagcta aataatgatg tgtataaaga actgaaaaag      1320
     tttatgcacg attacgacaa aacatcccca gaaatgagaa aataccttca gagcatcaac      1380
     gagtctatgt tccttatgaa aaaaatatct catcaagatt aa                         1422
//

If you have problems or comments...

PBIL Back to PBIL home page