(data stored in ACNUC7421 zone)

EMBL: BA000007.ESPY1

BA000007.ESPY1       Location/Qualifiers
FT   CDS_pept        63450..64202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="espY1"
FT                   /locus_tag="ECs_0061"
FT                   /product="T3SS effector-like protein EspY"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33484"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33484"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA11"
FT                   /protein_id="BAB33484.1"
FT                   /translation="MKVSVPGMPATLLNMSNNDIYKMVSGDKMDMKMNIFQRLWETLRH
FT                   LFWSDKQTEAYKLLFNFVNKKAGNINASKYFTGAVNENEKEKFIHSLELFNELKTCAKN
FT                   PDEMVAKGNMSWVAQTFGDIELSVTFFIENKEICTQTLQLHKGPGNLGVDLREAYLPGV
FT                   DMRDCYLGLKTMKGHNKVLYLEPGWNANLDGATLDGATLDGATVDGATHLYDEVIIINK
FT                   ITPKKIDTEEVATKQSTAEQITDNAIIE"
     atgaaagtat cagttccagg catgccggct acacttttaa atatgagcaa taacgatatt        60
     tataagatgg tgagcgggga caagatggac atgaagatga atatctttca acgcttgtgg       120
     gagacgttac gtcatctgtt ctggtcagat aaacagactg aggcttataa acttctgttc       180
     aatttcgtga ataaaaaggc tggcaacatc aacgcctcaa aatactttac tggggctgtc       240
     aacgagaatg agaaagaaaa gtttatccat agtctggaat tattcaatga actcaaaaca       300
     tgcgcaaaaa atccggatga gatggtcgca aagggcaata tgagctgggt cgcacagacc       360
     ttcggtgata tcgagttaag tgtcactttt tttattgaaa ataaggagat atgtactcag       420
     acgttgcagc tgcataaagg cccaggtaac ttgggcgttg atcttagaga ggcttacctt       480
     cccggcgttg acatgaggga ttgttacctt ggtctcaaaa caatgaaagg tcacaataaa       540
     gtcctttact tggaacctgg gtggaatgct aacctggacg gtgctaccct ggacggtgct       600
     accctggacg gtgctaccgt ggacggtgct acccacctat atgatgaggt aattattatt       660
     aataaaatca cccccaaaaa aattgatact gaagaagttg ctactaaaca aagtactgct       720
     gaacaaatta ctgacaacgc aattattgaa tga                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page