(data stored in ACNUC7421 zone)

EMBL: BA000007.ESPY2

BA000007.ESPY2       Location/Qualifiers
FT   CDS_pept        80672..81241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="espY2"
FT                   /locus_tag="ECs_0073"
FT                   /product="T3SS effector-like protein EspY"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33496"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33496"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA03"
FT                   /protein_id="BAB33496.1"
FT                   /translation="MKVRNPEQISIPASNTTKDPGLTNSQIIRMANLVKKTENMNIFEE
FT                   LWETLRNLFQSDKHSQTAARQILKDAFYFQNSDDYSKYFTGAVDGKARDKLTHWLIKFN
FT                   ELKEYAKDPENMAAKASLSPEGTLCVSFFIGDEAIFTLELQLKKSTRTGGIDLSNAYFN
FT                   GVVICGIDCLEVDLSNAETNNSRWYD"
     atgaaagtaa gaaacccaga acagattagt atccctgcta gtaataccac taaagatcca        60
     ggccttacta attctcagat tatcaggatg gctaacttgg tcaaaaagac cgagaatatg       120
     aatatctttg aagagctatg ggagacgtta cgcaatctct tccagtcaga taaacattcc       180
     cagactgcgg caaggcaaat tctgaaggat gcattttatt tccagaatag tgatgactac       240
     tcaaaatact ttaccggggc tgtcgacggg aaggcgcgtg ataagttaac tcactggctg       300
     ataaaattta atgaactcaa agaatacgca aaagatccgg aaaatatggc cgcgaaggcc       360
     tcactctcgc cagaaggtac gttatgcgtc agttttttta ttggcgatga ggcgatattt       420
     actctggagt tgcagctgaa aaagagcacc aggaccgggg ggattgatct gagtaatgct       480
     tactttaacg gggttgtcat ttgtggtatt gactgtctcg aggttgacct gagcaatgct       540
     gaaacgaaca atagccgttg gtatgactga                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page