(data stored in ACNUC7421 zone)

EMBL: BA000007.ESPY3

BA000007.ESPY3       Location/Qualifiers
FT   CDS_pept        complement(501538..503109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="espY3"
FT                   /locus_tag="ECs_0472"
FT                   /product="T3SS effector-like protein EspY"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33895"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33895"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XE85"
FT                   /protein_id="BAB33895.1"
FT                   /translation="MMKTITKQPILFTDVPVADLRNSMKQDLNQNLIERLWNKIRDFFL
FT                   DSDKQKAFKSIHKYINTLSVLNYNSALTPDPNFNIDATSDLDSYLKLDFDRLSPKQKQT
FT                   TLCCFWNKIASSLPEPYNSTIKHNIIFYKDGENLMIRGTISIVNEVVKTYSLPIEKDDN
FT                   GYYDFSGLYLAHSNISGKDPNKDPDIDFGIDMGNCNCSNVNFEHTYFYGVKFTNANCTN
FT                   ANFNNCRFKKCDLTNMNCTGAILDNAMIYGKEKEPEMQYPEADQIIQRITYQKSDGNET
FT                   KGMILTNCSCVKTTFNWADLSESDCQNVDFSEANLSNTILPDIVRMKGTKLYRTDLFNP
FT                   ILKTEAESTEEKDISPLAKIILDYIESDKNPESLNFEEKSTVIKIKQDIDNFIFYNQHL
FT                   KKIFNRAMNLQEKISRKKYNEFFKYIQAEAKQYFKDQYKLTKNDYLKKVPLTAQLIAKY
FT                   KMDDQLDQLLVTREIQDEIKSKIQDKIDELSKNLFNTMTETIENNFDDIFRQQSENMSN
FT                   YYEFVD"
     atgatgaaaa ccatcaccaa acaaccgatc ctgtttactg atgtaccggt tgcagattta        60
     agaaactcaa tgaagcaaga tttaaatcaa aatcttattg aaaggctgtg gaacaaaatt       120
     cgtgattttt ttctggacag tgataaacaa aaggcattta aatcgattca taaatacatc       180
     aatacattgt cagttctaaa ttataattca gcgttaactc cagatcccaa ctttaatata       240
     gatgcaacgt cagatttaga ctcatattta aagctggatt ttgatcgcct ctcgcccaaa       300
     caaaaacaga ccacgctttg ttgtttctgg aataaaattg catcctcatt gccagagcca       360
     tacaacagta ccatcaaaca taacattatt ttttataaag acggagaaaa tctgatgata       420
     cgtggaacta tctctattgt taacgaggta gtaaagactt attcactccc aatagaaaag       480
     gatgacaatg gatattacga tttcagcggt ctatatctag cacacagcaa tatttccggt       540
     aaagatccca ataaagatcc cgatatagat ttcggtatag atatgggaaa ctgtaactgc       600
     tcaaatgtca acttcgaaca tacttatttt tatggcgtca agtttacaaa tgcgaattgt       660
     acaaatgcga attttaacaa ttgtagattt aagaaatgcg acctgacaaa tatgaattgc       720
     actggcgcaa ttcttgataa tgcgatgata tatggtaaag aaaaagaacc tgagatgcaa       780
     tatccagaag cagatcaaat aatacaaagg ataacttatc agaaatcaga tgggaatgaa       840
     acgaaaggga tgattctaac taactgctcc tgtgtgaaaa ccactttcaa ttgggcagat       900
     ttatcagaaa gtgattgcca aaatgtggac tttagcgagg ctaatctttc aaacactatt       960
     cttcctgaca tcgtcaggat gaaaggcacg aaactttacc gtaccgacct ttttaatccg      1020
     atattaaaaa cagaagcaga atcaacagaa gaaaaagaca ttagcccatt agcaaaaatt      1080
     attcttgact atattgaatc agataaaaac cctgagtcat taaactttga agaaaaatca      1140
     acagttatta aaataaaaca agatatcgat aattttattt tctacaatca gcatttaaag      1200
     aaaatattca atcgcgcaat gaatcttcaa gaaaaaataa gcaggaaaaa gtataatgaa      1260
     ttttttaaat atatacaagc agaagccaaa caatatttca aagaccagta taaactaaca      1320
     aaaaatgatt atttgaagaa agtaccttta actgcacaat taattgcaaa atacaaaatg      1380
     gatgatcaat tggaccaact tttggttacc cgtgaaattc aagatgaaat aaaatcaaag      1440
     attcaagaca aaatagatga actttctaaa aatttattca acactatgac cgaaaccatt      1500
     gagaataatt ttgatgatat ttttcgtcaa cagtcagaga atatgagcaa ttattatgag      1560
     ttcgtcgact ga                                                          1572
//

If you have problems or comments...

PBIL Back to PBIL home page