(data stored in ACNUC7421 zone)

EMBL: BA000007.FABZ

BA000007.FABZ        Location/Qualifiers
FT   CDS_pept        205445..205900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="ECs_0182"
FT                   /product="(3R)-hydroxymyristoyl-[acyl carrier protein]
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33605"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33605"
FT                   /db_xref="GOA:P0A6Q8"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A6Q8"
FT                   /protein_id="BAB33605.2"
FT                   /translation="MTTNTHTLQIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVS
FT                   VNEPFFQGHFPGKPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRP
FT                   VVPGDQMIMEVTFEKTRRGLTRFKGVALVDGKVVCEATMMCARSREA"
     ttgactacta acactcatac tctgcagatt gaagagattt tagaacttct gccgcaccgt        60
     ttcccgttct tactggtgga tcgcgtgctg gattttgaag aaggtcgttt tctgcgcgca       120
     gtaaaaaatg tctctgtcaa tgagccattc ttccagggcc atttccctgg aaaaccgatt       180
     ttcccgggtg tgctgattct ggaagcaatg gcacaggcaa caggtattct ggcgtttaaa       240
     agcgtaggaa aactggaacc gggtgagctg tactacttcg ctggtattga cgaagcgcgc       300
     ttcaagcgcc cggtcgtgcc tggcgatcaa atgatcatgg aagtcacttt cgaaaaaacg       360
     cgccgcggcc tgacccgttt taaaggggtt gctctggtcg acggtaaagt agtttgcgaa       420
     gcaacgatga tgtgtgctcg tagccgggag gcctga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page