(data stored in ACNUC7421 zone)

EMBL: BA000007.FEPB

BA000007.FEPB        Location/Qualifiers
FT   CDS_pept        complement(705211..706167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepB"
FT                   /locus_tag="ECs_0631"
FT                   /product="ferrienterobactin ABC transporter periplasmic
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34054"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34054"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JBY6"
FT                   /protein_id="BAB34054.1"
FT                   /translation="MRLAPLYRNALLLTGLLFSGIAAVQAADWPRQITDSRGTHTLESQ
FT                   PQRIVSTSVTLTGSLLAIDAPVIASGATTPNNRVADDQGFLRQWSKVAKERKLQRLYIG
FT                   EPSTEAVAAQMPDLILISATGGDSALALYDQLSTIAPTLIINYDDKSWQALLTQLGEIT
FT                   GHEKQAAERIAQFDKQLAAAKEQIKLPPQPVTAIVYTAAAHSANLWTPESAQGQMLEQL
FT                   GFTLAKLPAGLNASQSQGKRHDIIQLGGENLAAGLNGESLFLFAGDQKDADAIYANPLL
FT                   AHLPAVQNKQVYALGTETFRLDYYSAMQVLERLKALF"
     gtgagactcg ccccgctcta ccgcaatgcc cttctattaa caggactttt gttttcagga        60
     atagccgcag ttcaggccgc cgactggccg cgtcagatta ctgacagccg tggcactcat       120
     accctggaaa gccagccgca gcgtattgtt tccaccagcg tcaccctgac cggctcactg       180
     ctggcgattg atgctccggt gatcgccagc ggcgcgacca cgccgaataa ccgcgtcgcg       240
     gatgaccagg gctttttacg ccagtggagc aaggtggcga aagaacgcaa actgcaacgg       300
     ctctatatcg gcgaaccgag caccgaagcc gttgccgcgc aaatgccgga tctgatttta       360
     attagcgcaa ccggcgggga ttcggcgctg gcgctgtatg atcagctttc caccatcgcc       420
     ccgacattaa tcatcaatta cgacgacaaa agctggcagg cgctgttaac gcaacttggc       480
     gaaattaccg ggcatgagaa acaagcggca gagcggattg cgcagtttga taagcaactg       540
     gcggcggcga aagagcaaat caaattaccg ccgcagccgg tcactgccat tgtctatact       600
     gccgctgcac acagtgccaa tctctggacg ccggaatcag cacaagggca gatgctggaa       660
     caactcggct ttacgctggc gaagttaccc gcagggttaa atgccagcca aagccagggt       720
     aaacgccatg acatcattca gcttggtggg gaaaatctgg ctgcagggtt aaatggcgag       780
     tcactattcc tgttcgccgg tgatcagaaa gatgccgatg ctatttatgc taatccgctg       840
     ctcgcgcacc tgcctgcagt acaaaacaag caggtttatg cgctgggaac cgagacgttc       900
     cgtctggatt actacagcgc catgcaagtg ctggaacgac ttaaggcgct gttttaa          957
//

If you have problems or comments...

PBIL Back to PBIL home page