(data stored in ACNUC7421 zone)

EMBL: BA000007.FHUD

BA000007.FHUD        Location/Qualifiers
FT   CDS_pept        174898..175788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuD"
FT                   /locus_tag="ECs_0156"
FT                   /product="iron(3+)-hydroxamate import ABC transporter
FT                   periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33579"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33579"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X8Z7"
FT                   /protein_id="BAB33579.1"
FT                   /translation="MSGLPLISRRRLLTAMALSPLLWQMNTAHAAAIDPNRIVALEWLP
FT                   VELLLALGIVPYGVADTINYRLWVSEPPLPESVIDVGLRTEPNLELLTEMKPSFMVWSA
FT                   GYGPSPEMLARIAPGRGFNFSDGKQPLAMARKSLTEMADLLNLQSAAETHLAQYEDFIR
FT                   SMNPRFVKRGARPLLLTTLIDPRHMLVFGPNSLFQEILDEYGIPNAWQGETNFWGSTAV
FT                   SIDRLAAYKDVDVLCFDHDNSKDMDALMATPLWQAMPFVRAGRFQRVPAVWFYGATLSA
FT                   MHFVRVLDNAIGGKA"
     atgagcggct tacctcttat ttcgcgccgt cgactgttaa cggcgatggc gctttctccg        60
     ttgttatggc agatgaatac cgcccacgcg gcggctattg acccaaatcg tattgtggcg       120
     ctggagtggc tgccggtgga attactactg gcgctcggca tcgtgcctta tggcgtggca       180
     gacaccatca actatcgact gtgggtcagc gaaccaccac tacctgaatc ggtgattgac       240
     gtcggtttgc gtacagaacc taacctcgaa ctgctgaccg aaatgaaacc gtcgtttatg       300
     gtctggtcgg cgggatatgg tccttcgcca gaaatgctgg ctcgtattgc gccggggcgt       360
     ggatttaact tcagcgacgg caaacagccg ctggcgatgg cgcgtaaatc gctgacggaa       420
     atggcggatt tacttaacct gcaaagcgca gcagaaacgc atttagcgca atatgaagac       480
     tttatccgca gcatgaaccc ccgctttgtg aagcgtggtg cgcgtccgtt attgctgacg       540
     acgcttatcg atccgcgcca tatgctggtc ttcggtccaa acagcttgtt ccaggaaatt       600
     cttgatgagt acggcatccc aaatgcctgg caaggggaaa ccaacttctg gggcagtacc       660
     gccgtcagca tcgatcgtct ggcagcgtat aaagacgttg atgtgctctg ttttgatcac       720
     gacaacagca aagacatgga tgcgctaatg gcaacgccgc tgtggcaggc catgccgttt       780
     gtccgcgccg gacgctttca gcgcgtaccc gcagtctggt tttatggtgc aactctctcg       840
     gcaatgcact ttgtgcgcgt tctggataac gccattggag gtaaagcgtg a                891
//

If you have problems or comments...

PBIL Back to PBIL home page