(data stored in ACNUC7421 zone)

EMBL: BA000007.FIXA

BA000007.FIXA        Location/Qualifiers
FT   CDS_pept        46817..47587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixA"
FT                   /locus_tag="ECs_0044"
FT                   /product="anaerobic carnitine reduction electron transfer
FT                   flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33467"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33467"
FT                   /db_xref="GOA:P60567"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR023463"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60567"
FT                   /protein_id="BAB33467.2"
FT                   /translation="MKIITCYKCVPDEQDIAVNNADGSLDFSKADAKISQYDLNAIEAA
FT                   CQLKQQAAEAQVTALSVGGKALTNAKGRKDVLSRGPDELIVVIDDQFEQALPQQTASAL
FT                   AAAAQKAGFDLILCGDGSSDLYAQQVGLLVGEILNIPAVNGVSKIISLTADTLTVEREL
FT                   EDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIGFNAEAAWSEQ
FT                   QVAAPKQRERQRIVIEGDGEEQIAAFAENLRKVI"
     atgaagatta ttacttgcta taagtgcgtg cctgatgaac aggatattgc ggtcaataat        60
     gctgatggtt cgttagactt cagtaaagcc gatgccaaaa taagccaata cgatctcaac       120
     gctattgaag cggcttgcca gctaaagcaa caggcagcag aggcgcaggt gacggcccta       180
     agtgtgggcg gtaaagccct gaccaacgcc aaagggcgta aagatgtgct atcgcgcggt       240
     ccggatgaac tgattgtggt gattgatgac cagttcgagc aggcactgcc gcaacaaacg       300
     gcgagcgcac tggctgcagc cgcccagaaa gcaggctttg atttgatcct ctgtggcgat       360
     ggttcttccg acctttatgc ccagcaggtt ggtttgctgg taggcgaaat cctcaatatt       420
     ccggcagtta acggcgtcag caaaattatc tccctgacgg cagataccct caccgttgag       480
     cgcgaactgg aagatgaaac cgaaacctta agcattccac tgcctgcggt tgttgctgtt       540
     tccactgata tcaactcccc acaaattcct tcgatgaaag ccattctcgg cgcggcgaaa       600
     aagccagtcc aggtatggtc ggcggcggat atcggtttta acgcagaggc agcatggtca       660
     gaacaacagg ttgccgcgcc gaaacagcgc gagcgtcagc gcatcgtgat tgaaggcgac       720
     ggcgaagaac agatcgccgc atttgctgaa aatcttcgca aagtcattta a                771
//

If you have problems or comments...

PBIL Back to PBIL home page