(data stored in ACNUC7421 zone)

EMBL: BA000007.FLHA

BA000007.FLHA        Location/Qualifiers
FT   CDS_pept        complement(286245..287984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhA"
FT                   /locus_tag="ECs_0256"
FT                   /product="flagellar export pore protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33680"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33680"
FT                   /db_xref="GOA:Q8X7Q2"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7Q2"
FT                   /protein_id="BAB33680.2"
FT                   /translation="MLSRSDLLTLLTINFIVVTKGAERISEVSARFTLDAMPGKQMAID
FT                   ADLNAGLINQAQAQTRRKDVASEADFYGAMDGASKFVRGDAIAGMMILAINLIGGVCIG
FT                   IFKYNLSADAAFQQYVLMTIGDGLVAQIPSLLLSTAAAIIVTRVSDNGDIAHDVRHQLL
FT                   ASPSVLYTATGIMFVLAVVPGMPHLPFLLFSALLGFTGWRMSKQPQAAEAEEKSLETLT
FT                   RTITETSEQQVSWETIPLIEPISLSLGYKLVALVDKAQGNPLTQRIRGVRQVISDGNGV
FT                   LLPEIRIRENFRLKPSQYAIFINGIKADEADIPADKLMALPSSETYGEIDGVLGNDPAY
FT                   GMPVTWIQPAQKAKALNMGYQVIDSASVIATHVNKIVRSYIPDLFNYDDITQLHNRLSS
FT                   MAPRLAEDLSAALNYSQLLKVYRALLTEGVSLRDIVTIATVLVASSAVTKDHILLAADV
FT                   RLALRRSITHPFVRKQELTVYTLNNELENLLTNVVNQAQQGGKVMLDSVPVDPNMLNQF
FT                   QSTMPQVKEQMKAAGKDPVLLVPPQLRPLLARYARLFAPGLHVLSYNEVPDELELKIMG
FT                   ALS"
     atgctttcac gctcggattt actgacgctg ttgacaatca actttatcgt cgtcaccaaa        60
     ggggccgagc gtatttccga ggtttctgcc cgctttaccc tggatgcgat gcccggcaaa       120
     cagatggcga ttgacgccga tcttaacgcc ggattgatca accaggcaca ggcgcaaacc       180
     cggcgtaaag atgttgccag tgaggccgat ttctacggcg cgatggacgg ggcatcgaag       240
     tttgtgcgcg gggatgccat cgccgggatg atgattctgg cgattaacct gatcggcggc       300
     gtctgtatcg ggatatttaa atacaacctg agcgccgacg ccgccttcca gcaatatgtg       360
     ctgatgacca tcggcgatgg gctggtggcg cagatccctt ccctcctgct ctccaccgca       420
     gcggcgatta tcgtcacccg cgtcagcgac aacggcgata tcgcccatga cgtgcgccac       480
     cagctgctgg caagcccgtc ggtgctctac accgccaccg ggattatgtt tgtgctggcg       540
     gtggtgccgg gaatgccgca cctgccgttt ttgctgttca gcgccctgct gggttttacc       600
     ggctggcgga tgagcaaaca gccgcaggcg gcggaggcgg aagagaaaag cctcgaaacg       660
     ctgacccgca ccatcactga aaccagcgag caacaggtca gttgggaaac cattccgctt       720
     atcgagccta tcagtttaag cctcggctac aagctggtgg cgctggtcga taaagcgcag       780
     ggcaacccgc tcacccagcg tattcgcggc gtacggcagg tgatatccga cggtaacggc       840
     gtgctgctgc cggagatccg cattcgggaa aacttccgcc tcaagcccag ccagtacgcc       900
     attttcatca acggcattaa ggccgatgaa gcggatattc cggcggataa actgatggcg       960
     ctgccctcca gcgaaaccta cggcgagatt gacggcgtgc tggggaacga cccggcgtac      1020
     gggatgccgg tgacctggat ccagcccgcg cagaaggcga aggcgctgaa tatggggtat      1080
     caggtgatcg acagcgccag cgtgattgcc acgcatgtga acaagattgt gcgcagctat      1140
     attcctgatt tgtttaatta tgatgacatc acgcagctgc ataaccgcct gtcgtcgatg      1200
     gccccgcgcc tggcggaaga tttgagcgcg gcgctgaatt acagccagtt gctgaaagtg      1260
     taccgtgcgc tgctgaccga aggcgtttcc ctgcgcgata tcgtcaccat cgccaccgtg      1320
     ctggtcgcca gtagcgcggt gactaaagat catattctgc tggcggccga tgtgcgcctg      1380
     gcgctgcggc gcagcattac ccatccgttc gttcgcaagc aggagctgac ggtgtatacg      1440
     ctgaataatg agctggaaaa tctgctgact aacgtagtga atcaggcgca acagggcggt      1500
     aaagtgatgc tcgacagcgt gccagtggac ccgaatatgc tcaaccagtt ccagagcacg      1560
     atgccgcagg tgaaagagca gatgaaagcg gcggggaaag acccggtgct gctggtgccg      1620
     ccgcagctgc gccctttgct ggcgcgctat gcaaggttgt ttgcgccggg gctgcatgtg      1680
     ctgtcgtata acgaagtgcc ggatgagctg gagttgaaga taatgggggc gttgagttga      1740
//

If you have problems or comments...

PBIL Back to PBIL home page