(data stored in ACNUC7421 zone)

EMBL: BA000007.FRSA

BA000007.FRSA        Location/Qualifiers
FT   CDS_pept        294415..295659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frsA"
FT                   /locus_tag="ECs_0266"
FT                   /product="fermentation-respiration switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33689"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33689"
FT                   /db_xref="GOA:Q8X7N7"
FT                   /db_xref="InterPro:IPR010520"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X7N7"
FT                   /protein_id="BAB33689.1"
FT                   /translation="MTQANLSETLFKPRFKHPETSTLVRRFNHGAQPPVQSALDGKTIP
FT                   HWYRMINRLMWIWRGIDPREILDVQARIVMSDAERTDDDLYDTVIGYRGGNWIYEWATQ
FT                   AMVWQQKACAEEDPQLSGRHWLHAATLYNIAAYPHLKGDDLAEQAQALSNRAYEEAAQR
FT                   LPGTMRQMEFTVPGGAPITGFLHMPKGDGPFPTVLMCGGLDAMQTDYYSLYERYFAPRG
FT                   IAMLTIDMPSVGFSSKWKLTQDSCLLHQRVLKALPNVPWVDHTRVAAFGFRFGANVAVR
FT                   LAYLESPRLKAVACLGPVVHTLLSDFKCQQQVPEMYLDVLASRLGMHDASDEALRVELN
FT                   RYSLKVQGLLGRRCPTPMLSGYWKNDPFSPEEDSRLITSSSADGKLLEIPFNPVYRNFD
FT                   KGLQEITDWIEKRLC"
     atgacacagg caaacctgag cgaaaccctg ttcaaacccc gctttaaaca tcctgaaacc        60
     tcgacgctag tccgccgctt taatcacggc gcacaaccgc ctgtgcagtc ggcccttgat       120
     ggtaaaacca tccctcactg gtatcgcatg attaaccgtc tgatgtggat ctggcgcggc       180
     attgacccac gcgaaatcct cgacgtccag gcacgtattg tgatgagcga tgccgaacgt       240
     accgacgatg atttatacga tacggtgatt ggctaccgtg gcggcaactg gatttatgag       300
     tgggccaccc aggcgatggt gtggcaacaa aaagcctgtg cggaagaaga tccgcaactc       360
     agtggtcgtc actggctgca tgcggctacg ttgtacaaca ttgccgccta tcctcatctg       420
     aaaggagatg acctggccga gcaagcgcag gctttgtcaa accgcgccta tgaagaggcc       480
     gctcagcgtc taccgggcac gatgcgacag atggagttta ccgtacccgg cggtgcgccc       540
     atcaccggct ttttgcatat gccgaaaggc gatggcccgt tcccgacggt attaatgtgt       600
     ggtggtctgg atgcgatgca gacggactat tacagcctgt atgaacgtta ttttgcgccg       660
     cgcggcattg cgatgctgac tattgatatg ccgtcggtgg gcttttcttc aaaatggaag       720
     ctcacccagg actcctgcct gttgcatcag cgcgtcttaa aggctctgcc taacgtaccg       780
     tgggtggatc acactcgcgt cgcggccttt ggtttccgtt tcggcgctaa cgttgccgtg       840
     cgtctggcat atcttgaatc gccgcgtctg aaagcggttg cctgtcttgg tccggtagtt       900
     cataccctgt tgagtgattt taagtgccag caacaggtgc cggaaatgta tcttgacgtt       960
     ctggcgagtc gtttggggat gcatgatgct tccgacgaag cgttgcgcgt ggagctgaat      1020
     cgctattcat taaaagtgca aggattgctg ggacgtcgat gcccaacgcc aatgttatca      1080
     ggctactgga agaacgatcc gttcagcccg gaagaggact cacgcttaat cacctcatca      1140
     tctgctgacg gtaaattatt agagatccca tttaacccgg tgtatcggaa ttttgacaaa      1200
     ggtcttcagg aaatcaccga ctggatcgaa aaacgcttgt gttaa                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page