(data stored in ACNUC7421 zone)

EMBL: BA000007.FSR

BA000007.FSR         Location/Qualifiers
FT   CDS_pept        complement(569267..570487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fsr"
FT                   /locus_tag="ECs_0532"
FT                   /product="fosmidomycin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33955"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33955"
FT                   /db_xref="GOA:Q8XD36"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XD36"
FT                   /protein_id="BAB33955.1"
FT                   /translation="MAMSEQTQPVAGAAASTTKARTSFGILGAISLSHLLNDMIQSLIL
FT                   AIYPLLQSEFSLTFMQIGMITLTFQLASSLLQPVVGYWTDKYPMPWSLPIGMCFTLSGL
FT                   VLLALAGSFGAVLLAAALVGTGSSVFHPESSRVARMASGGRHGLAQSIFQVGGNFGSSL
FT                   GPLLAAVIIAPYGKGNVAWFVLAALLAIVVLAQISRWYSAQHRMNKGKPKATIINPLPR
FT                   NKVVLAVSILLILIFSKYFYMASISSYYTFYLMQKFGLSIQNAQLHLFAFLFAVAAGTV
FT                   IGGPVGDKIGRKYVIWGSILGVAPFTLILPYASLHWTGVLTVIIGFILASAFSAILVYA
FT                   QELLPGRIGMVSGLFFGFAFGMGGLGAAVLGLIADHTSIELVYKICAFLPLLGMLTIFL
FT                   PDNRHKD"
     atggcaatga gtgaacaaac ccagcctgtg gcgggcgcgg ctgcgtcaac gaccaaggcc        60
     cgaacatcgt ttggtatttt aggtgctatc agcctctcac atctgctgaa cgacatgatc       120
     caatcgctga ttctggcgat ttatcctctg cttcagtcag aattttctct gacatttatg       180
     cagattggca tgataaccct caccttccag ctcgcctctt cgctactgca accagtggtc       240
     ggctactgga ccgataaata tccgatgccg tggtcgttgc caattggcat gtgctttacc       300
     ttaagtggtc tggtgctgct tgcgctggcg ggcagttttg gcgcagttct gctggcggcg       360
     gcgctggtcg gtaccggttc atcggtcttt catccggaat cttctcgcgt ggcccgtatg       420
     gcttccggcg ggcggcatgg cctggcacaa tctatctttc aggtcggcgg caactttggc       480
     agttccctgg gacccttgct ggcggcggtg attatcgcgc cttatggcaa aggcaacgtt       540
     gcctggtttg tgcttgcggc actgctggcg atcgtggtgt tggcgcaaat cagccgttgg       600
     tactcggcac agcaccgaat gaataaagga aaacccaaag cgacgattat caatccactg       660
     ccgcgcaaca aagtggtact ggcggtcagc attctgttaa tcctcatttt ctcgaaatat       720
     ttctatatgg cgagcatcag cagctattac accttttatc tgatgcaaaa attcggatta       780
     tctatccaga atgctcagct tcatctgttt gccttcctgt ttgccgttgc ggcaggtacg       840
     gtgatcggcg ggcctgtagg ggataaaatt gggcggaaat atgtgatttg gggctctatc       900
     ctcggcgttg cgccgtttac gctgatttta ccctacgcca gcctgcactg gacgggggtt       960
     ttaacggtga ttattggatt tatcctcgct tcggcattct ctgccattct ggtctacgct      1020
     caggagctgc ttccaggacg tatcggtatg gtttctggac tctttttcgg ttttgctttc      1080
     ggcatgggag gtctgggagc ggcagttctg gggcttatcg ccgatcacac cagcatcgag      1140
     ttagtctata aaatatgtgc tttcctgcca ctattgggga tgttgaccat attcctgcct      1200
     gataaccggc ataaagactg a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page