(data stored in ACNUC7421 zone)

EMBL: BA000007.GLTI

BA000007.GLTI        Location/Qualifiers
FT   CDS_pept        complement(768200..769108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltI"
FT                   /locus_tag="ECs_0694"
FT                   /product="glutamate/aspartate periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34117"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34117"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBL6"
FT                   /protein_id="BAB34117.1"
FT                   /translation="MQLRKPATAILALALSAGLAQADDAAPAAGSTLDKIAKNGVIVVG
FT                   HRESSVPFSYYDNQQKVVGYSQDYSNAIVEAVKKKLNKPDLQVKLIPITSQNRIPLLQN
FT                   GTFDFECGSTTNNVERQKQAAFSDTIFVVGTRLLTKKGGDIKDFADLKGKAVVVTSGTT
FT                   SEVLLNKLNEEQKMNMRIISAKDHGDSFRTLESGRAVAFMMDDALLAGERAKAKKPDNW
FT                   DIVGKPQSQEAYGCMLRKDDPQFKKLMDDTIAQVQTSGEAEKWFDKWFKNPIPPKNLNM
FT                   NFELSDEMKALFKEPNDKALN"
     atgcaattac gtaaacctgc cacagcaatc ctggccctgg cgctttccgc aggactggca        60
     caggcagatg acgccgcccc ggcagcgggc agtacgctgg acaaaatcgc caaaaacggc       120
     gtgattgtcg tcggtcaccg tgaatcttca gtacctttct cttattacga caatcagcaa       180
     aaagtggtgg gttattcgca ggattactcc aacgccattg ttgaagcagt gaaaaagaaa       240
     ctcaacaaac cggacttgca ggtgaaactg attccgatta cctcacaaaa ccgtattccg       300
     ctgctgcaaa acggcacttt tgattttgaa tgtggttcta ccaccaacaa cgtcgaacgc       360
     caaaaacagg cggctttctc tgacactatt ttcgtggtcg gtacgcgcct gttgaccaaa       420
     aagggcggcg atatcaaaga ttttgccgac ctgaaaggca aagccgtagt cgtcacttcc       480
     ggcactacct ctgaagtttt gctcaacaaa ctgaatgaag agcaaaaaat gaatatgcgc       540
     atcatcagcg ccaaagatca cggtgactct ttccgtaccc tggaaagcgg tcgtgccgtt       600
     gcctttatga tggatgatgc tctgctggcc ggtgaacgtg cgaaagcgaa gaaaccagac       660
     aactgggata tcgtcggcaa gccgcagtct caggaagcct atggttgcat gttgcgtaaa       720
     gacgatccgc agttcaaaaa gctgatggat gacactatcg ctcaggtgca gacctccggt       780
     gaagcggaaa aatggtttga taaatggttc aaaaatccca ttccgccgaa aaacctgaac       840
     atgaatttcg aactgtcaga cgaaatgaaa gcactgttca aagaaccgaa tgacaaagca       900
     ctgaactaa                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page