(data stored in ACNUC7421 zone)

EMBL: BA000007.GLTL

BA000007.GLTL        Location/Qualifiers
FT   CDS_pept        complement(765891..766616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltL"
FT                   /locus_tag="ECs_0691"
FT                   /product="ATP-binding protein of glutamate/aspartate
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34114"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34114"
FT                   /db_xref="GOA:P0AAG4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAG4"
FT                   /protein_id="BAB34114.1"
FT                   /translation="MITLKNVSKWYGHFQVLTDCSTEVKKGEVVVVCGPSGSGKSTLIK
FT                   TVNGLEPVQQGEITVDGIVVNDKKTDLAKLRSRVGMVFQHFELFPHLSIIENLTLAQVK
FT                   VLKRDKAPAREKALKLLERVGLSAHANKFPAQLSGGQQQRVAIARALCMDPIAMLFDEP
FT                   TSALDPEMINEVLDVMVELANEGMTMMVVTHEMGFARKVANRVIFMDEGKIVEDSPKDA
FT                   FFDDPKSDRAKDFLAKILH"
     atgattaccc tgaaaaatgt ttcaaaatgg tatggtcact ttcaggtgct gaccgactgc        60
     tcaaccgaag tgaaaaaagg cgaagtggtg gtggtttgcg gcccgtctgg ttccggcaaa       120
     tcaacgctga ttaaaaccgt caacggcctc gaaccagtgc agcaaggtga aatcaccgtc       180
     gatggtatcg tggttaacga caagaaaacc gatctggcaa agctgcgttc tcgcgtcggg       240
     atggtattcc aacatttcga gctgttccct catctgtcga ttatcgaaaa cctgaccctg       300
     gcgcaggtga aagtgcttaa acgcgataaa gcaccggctc gtgaaaaagc attgaaattg       360
     ctggagcgcg tgggactttc cgcacatgcc aataaatttc cggcgcagct ttccggcggc       420
     cagcagcagc gtgtggcaat tgctcgcgca ttgtgtatgg atcctattgc gatgctgttc       480
     gacgaaccca catcggcact agacccggag atgatcaacg aagtactgga cgtgatggtg       540
     gaactggcga acgaggggat gaccatgatg gtggtgaccc acgaaatggg ctttgcccgt       600
     aaagtggcga atcgggtgat ctttatggat gagggtaaaa ttgttgaaga ctcgccgaaa       660
     gatgcgttct tcgatgatcc gaaatcggac cgcgcaaaag acttcctcgc gaaaatcctg       720
     cattaa                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page