(data stored in ACNUC7421 zone)

EMBL: BA000007.GLXK

BA000007.GLXK        Location/Qualifiers
FT   CDS_pept        634397..635542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glxK"
FT                   /locus_tag="ECs_0576"
FT                   /product="glycerate kinase II"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33999"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33999"
FT                   /db_xref="GOA:Q8XCW0"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCW0"
FT                   /protein_id="BAB33999.1"
FT                   /translation="MKIVIAPDSFKESLSAEKCCQAIKAGFSTLFPDANYICLPIADGG
FT                   EGTVDAMVAATGGNIVTLEVCGPMGEKVNAFYGITGDGKTAVIEMAAASGLMLVAPEKR
FT                   NPLLASSFGTGELIRHALDNGIRHIILGIGGSATVDGGMGMAQALGVRFLDADGQVLVA
FT                   NGGNLARVASIEMEECDPRLANCHIEVACDVDNPLVGARGAAAVFGPQKGATPEMVEEL
FT                   EQGLQNYARVLQQQTEINVCQMAGGGAAGGMGIAAAVFLNADIKPGIEIVLRAVNLEQA
FT                   VQGAALVITGEGRIDSQTAGGKAPLGVASVAKQFNVPVIGIAGVLGDGVEVVHQYGIDA
FT                   VFSILPRLAPLAEVLASGETNLFNSARNIACAIKIGQGIKN"
     atgaagattg tcattgcgcc agactctttt aaagagagct tgagtgcaga aaaatgttgt        60
     caggcaatta aagccgggtt ttcgaccctc tttcccgatg cgaactatat ctgtttgccg       120
     atagcggatg gcggcgaagg gacggtggat gcgatggtcg ccgcgacggg cggcaacatc       180
     gtgacgcttg aagtctgcgg gccgatgggc gaaaaagtga atgcttttta tggcattacc       240
     ggcgacggga aaacggcggt gattgagatg gcggcagcaa gtggcctgat gctggtcgcg       300
     cctgaaaagc gtaatccgtt gctggcctcc agttttggta cgggggagtt aattcgtcat       360
     gcgctggata acggcattcg ccatattatt ctcggcattg gcggcagtgc gacggtcgac       420
     ggcggtatgg gcatggcgca ggcgctcggt gtgcgtttcc ttgatgccga cggtcaggtg       480
     ctggtggcta acggcggcaa tttagcgcgc gtggcaagca ttgagatgga ggaatgcgat       540
     ccgcgtctgg cgaactgcca tattgaagta gcatgtgacg ttgataaccc gctggtaggg       600
     gcacgcggcg cggcggcggt gtttggcccg caaaaagggg caacgccgga gatggtcgaa       660
     gaacttgaac aggggctgca aaattacgcc cgtgttttac aacagcaaac tgaaattaat       720
     gtctgccaga tggcgggcgg tggcgctgcg ggcggtatgg ggattgcggc ggcggtattc       780
     ctcaatgcgg atattaaacc gggtattgag attgtactgc gggcggtcaa cctggagcag       840
     gcggtgcagg gggcagcact ggtgatcacc ggggaagggc gcattgactc gcaaacggca       900
     ggcggtaaag cgccgctggg cgttgcgtcg gtggcgaagc agtttaatgt accggtgatt       960
     gggattgctg gcgtattggg tgatggcgtg gaagtggtgc accagtacgg cattgatgcg      1020
     gtattcagca ttttgccacg tctggcacct ttagccgaag tgctcgccag cggtgaaacc      1080
     aatctcttca acagcgcgcg aaatattgcc tgcgccatta aaataggtca gggaattaaa      1140
     aactga                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page