(data stored in ACNUC7421 zone)

EMBL: BA000007.HOFB

BA000007.HOFB        Location/Qualifiers
FT   CDS_pept        complement(120204..121589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hofB"
FT                   /locus_tag="ECs_0111"
FT                   /product="type II secretion system protein HofB"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33534"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33534"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X975"
FT                   /protein_id="BAB33534.1"
FT                   /translation="MNIPQLTALCLRYQGVLLDASEEVVHVAVVDAPSHELLDALHFAT
FT                   TKRIEITCWTRQQMEGHASRTQQTLPVAVQEKHQPKAELLTRTLQSALEQRASDIHIEP
FT                   ADNAYRIRLRIDGVLHPLPDVSPDAGVALTARLKVLGNLDIAEHRLPQDGQFTVELAGN
FT                   AVSFRIATLPCRGGEKVVLRLLQQVSQALDVNTLGMQPLQLAGFAHALQQPQGLVLVTG
FT                   PTGSGKTVTLYSALQKLNTADINICSVEDPVEIPIAGLNQTQIHPRAGLTFQGVLRALL
FT                   RQDPDVIMIGEIRDGETAEIAIKAAQTGHLVLSTLHTNSTCETLVRLQQMGVARWMLSS
FT                   ALTLVIAQRLVRKLCPHCRRQQGEPIHIPVNVWPSPLPHWQAPGCVHCYHGFYGRTALF
FT                   EVLPITPVIRQLISANTDVESLETHARQAGMRTLFENGCLAVEQGLTTFEELIRVLGMP
FT                   HGE"
     atgaatattc cacagctcac ggccctgtgc ctgcgttatc agggagtctt gctggatgcc        60
     agcgaagaag tggttcatgt tgcggtggtc gatgccccct cacatgagtt gctggacgca       120
     ttgcatttcg ctaccaccaa acgtattgag atcacctgct ggacgcgcca acaaatggaa       180
     ggtcacgcca gtcgcacaca acagacattg cccgtagctg ttcaggagaa gcatcagccc       240
     aaagcagagt tgctgactcg aacgttacaa tctgcgctgg aacaacgcgc gtctgatatt       300
     catatcgaac cagcggacaa tgcctaccgc atccgcttgc gtatcgacgg cgtattgcat       360
     cctttaccgg atgtttcacc ggatgccgga gtcgcattaa ccgccagatt aaaagtgctg       420
     ggaaacctgg atattgcgga acatcgcctg ccgcaggacg ggcaattcac tgtcgaactg       480
     gcaggaaacg ccgtctcatt tcgtattgcg accttaccat gtcggggtgg tgaaaaggtg       540
     gtattaaggt tgttacagca ggtgagccag gcactggatg ttaacacgct gggaatgcag       600
     ccgttacaac tggcgggctt tgctcatgcc ttgcaacaac cacagggact ggtgctggta       660
     actggcccta ccggcagcgg caaaacggtc acgctttata gtgccctgca aaagctgaat       720
     accgctgaca ttaatatttg tagcgtcgaa gatccggttg agatccccat agccggacta       780
     aaccagacgc aaatccatcc gcgtgccgga ctcacctttc agggcgtttt gcgtgcgtta       840
     ttgcgccagg atcctgacgt catcatgatc ggagagatcc gcgatggcga aacggcagaa       900
     attgccatta aagccgcgca aaccggtcac ctggtgttgt ctaccctaca cactaattcc       960
     acctgcgaaa cgctggtacg tttacagcaa atgggggtcg cccgctggat gctatcatcg      1020
     gcgcttacgc tggtaatagc ccagcgtctg gtacgcaaac tttgcccaca ttgtcgccgg      1080
     cagcaagggg agcccatcca cattccagtc aatgtatggc cgtcgccgct gccccactgg      1140
     caagcacccg gttgtgtaca ttgctaccac ggtttttatg gtcgcactgc cttatttgaa      1200
     gttctgccca taacaccggt catacgtcag cttatttccg ctaataccga cgttgaatcg      1260
     ctggaaacgc acgcccgaca ggcgggtatg cgaacgcttt ttgaaaacgg ctgcctggcc      1320
     gtggagcaag gcttaaccac ctttgaagag ttaatccgcg tattggggat gccgcatggc      1380
     gagtaa                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page