(data stored in ACNUC7421 zone)

EMBL: BA000007.HOFC

BA000007.HOFC        Location/Qualifiers
FT   CDS_pept        complement(119012..120214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hofC"
FT                   /locus_tag="ECs_0110"
FT                   /product="assembly protein in type IV pilin biogenesis
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33533"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33533"
FT                   /db_xref="GOA:Q8X977"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X977"
FT                   /protein_id="BAB33533.1"
FT                   /translation="MASKQLWRWHGITGDGNAQDGMLWAESRTLLLMALQQQMVTPLSL
FT                   KRIAINSAQWRGDKSAEVIHQLATLLKAGLTLSEGLALLAEQHPSKQWQALLQSLAHDL
FT                   EQGIAFSNALLPWSEVFPPLYQAMIRTGELTGKLDECCFELARQQRAQRQLTDKVKSAL
FT                   RYPIIILAMAIMVVVAMLHFVLPEFAAIYKTFNTPLPALTQGIMTLADFSGEWGWLLVL
FT                   FGIMLTIANKLLMRRPTWLIARQKLLLRIPIMGSLMRGQKLTQIFTILALTQSAGITFL
FT                   QGVESVRETMRCPYWVQLLTQIQHDISNGHPIWLALKNAGEFSPLCLQLVRTGEASGSL
FT                   DLMLDNIAHHHRDNTMALADNLAALLEPALLIITGGIIGTLVVAMYLPIFHLGDAMSGM
FT                   G"
     atggcgagta agcaactctg gcgctggcat ggcataaccg gcgacggcaa tgcgcaagat        60
     gggatgctat gggcagagag ccgtacttta ctgcttatgg cactacagca acagatggtt       120
     accccactaa gcctgaagcg aattgctatc aattctgcgc agtggcgagg agataaaagc       180
     gcggaagtca ttcatcaact ggcgacgcta cttaaagccg ggttaacgct ttctgaaggg       240
     ctggcactgc tggcggaaca gcatcccagt aagcaatggc aagcgttgct gcaatctctg       300
     gcacacgatc tcgaacaggg cattgccttt tccaatgcct tattaccctg gtcagaggta       360
     tttccgccgc tctatcaggc gatgatccgc acgggtgaac tgaccggtaa gctggatgaa       420
     tgctgctttg aactggcgcg tcagcaaaga gcccagcgtc agttgaccga caaagtaaaa       480
     tcagcgttac gttatcccat catcatttta gcgatggcaa tcatggtggt tgtggcaatg       540
     ctgcattttg ttctgccgga gtttgccgct atctataaga ccttcaacac cccactaccg       600
     gcactaacgc aggggatcat gacgctggca gactttagtg gcgaatgggg ctggctgctg       660
     gtgttgttcg gcattatgct gacgatagcc aataagttgc tgatgcgccg cccgacctgg       720
     cttatcgcgc ggcagaaatt gctgttacgc atcccgatta tggggtcact gatgcgggga       780
     caaaaactca cgcagatctt tacgattctg gcgctgactc aaagtgcagg cattactttt       840
     ttacagggcg tagagagcgt cagagaaaca atgcgctgcc cgtactgggt gcaacttctg       900
     acacaaatcc agcacgatat cagtaacggt catcccatct ggctggcgtt aaaaaatgcc       960
     ggtgagttta gcccgctctg tttgcaatta gtgagaacgg gagaggcctc cggctcgctg      1020
     gatctcatgt tagacaacat cgcccatcat catcgggata acacaatggc gctggcggat      1080
     aacctagcag ccttactgga accggcgttg ctgatcataa cgggaggaat tatcggtacg      1140
     ctggtggtgg cgatgtatct gccaattttc catttaggcg atgcgatgag tgggatggga      1200
     taa                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page