(data stored in ACNUC7421 zone)

EMBL: BA000007.HOKE

BA000007.HOKE        Location/Qualifiers
FT   CDS_pept        690339..690491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hokE"
FT                   /locus_tag="ECs_0620"
FT                   /product="small toxic membrane polypeptide HokE"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34043"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34043"
FT                   /db_xref="GOA:Q8XBX0"
FT                   /db_xref="InterPro:IPR000021"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XBX0"
FT                   /protein_id="BAB34043.1"
FT                   /translation="MLTKYALVAVIVLCLTVPGFTLLVGDSLCEFTVKERNIEFRAVLA
FT                   YEPKK"
     atgctgacga aatatgccct tgtggcagtc atagtgctgt gtttgacggt accgggattt        60
     acgcttctgg tcggagactc gctgtgtgag tttacggtga aggaacgtaa tattgagttc       120
     agggctgttc tcgcttacga accgaagaag tag                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page