(data stored in ACNUC7421 zone)

EMBL: BA000007.HTPG

BA000007.HTPG        Location/Qualifiers
FT   CDS_pept        561016..562890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpG"
FT                   /locus_tag="ECs_0526"
FT                   /product="heat shock protein Hsp90"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33949"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33949"
FT                   /db_xref="GOA:P0A6Z5"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A6Z5"
FT                   /protein_id="BAB33949.1"
FT                   /translation="MKGQETRGFQSEVKQLLHLMIHSLYSNKEIFLRELISNASDAADK
FT                   LRFRALSNPDLYEGDGELRVRVSFDKDKRTLTISDNGVGMTRDEVIDHLGTIAKSGTKS
FT                   FLESLGSDQAKDSQLIGQFGVGFYSAFIVADKVTVRTRAAGEKPENGVFWESAGEGEYT
FT                   VADITKEDRGTEITLHLREGEDEFLDDWRVRSIISKYSDHIALPVEIEKREEKDGETVI
FT                   SWEKINKAQALWTRNKSEITDEEYKEFYKHIAHDFNDPLTWSHNRVEGKQEYTSLLYIP
FT                   SQAPWDMWNRDHKHGLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSSDLPLNVSREILQ
FT                   DSTVTRNLRNALTKRVLQMLEKLAKDDAEKYQTFWQQFGLVLKEGPAEDFANQEAIAKL
FT                   LRFASTHTDSSAQTVSLEDYVSRMKEGQEKIYYITADSYAAAKSSPHLELLRKKGIEVL
FT                   LLSDRIDEWMMNYLTEFDGKPFQSVSKVDESLEKLADEVDESAKEAEKALTPFIDRVKA
FT                   LLGERVKDVRLTHRLTDTPAIVSTDADEMSTQMAKLFAAAGQKVPEVKYIFELNPDHVL
FT                   VKRAADTEDEAKFSEWVELLLDQALLAERGTLEDPNLFIRRMNQLLVS"
     atgaaaggac aagaaactcg tggttttcag tcagaagtga aacagcttct gcacctgatg        60
     atccattctc tctattccaa taaagaaatc ttcctgcgtg agcttatctc taacgcctcc       120
     gatgcggcgg acaagttgcg tttccgtgcg ctctctaacc cggacctgta cgaaggtgat       180
     ggcgaactgc gcgttcgtgt ctctttcgat aaagacaagc gcacgctgac catctccgat       240
     aacggcgtgg ggatgacccg cgacgaagtg attgaccatc tggggactat cgctaaatcc       300
     ggtaccaaat cattcctcga atccctgggt tctgaccagg cgaaagacag ccagctgatc       360
     ggtcagtttg gtgttggttt ctactctgcg tttatcgtgg ccgacaaagt gaccgtgcgt       420
     actcgcgcgg caggcgaaaa accagaaaac ggcgtcttct gggaatcggc tggcgaaggt       480
     gaatataccg ttgccgacat caccaaagaa gatcgtggta ctgaaatcac cctgcatctg       540
     cgtgaaggcg aagacgagtt cctcgatgac tggcgcgtgc gttccatcat cagcaaatac       600
     tccgaccata tcgcgctgcc ggtagagatc gaaaaacgcg aagagaaaga cggcgaaacc       660
     gttatctcct gggagaaaat taacaaagcg caggcgctgt ggactcgtaa caagtcggaa       720
     atcaccgatg aagagtacaa agagttctac aaacacatcg cccacgattt taacgatccg       780
     ctgacctgga gccacaaccg tgttgaaggt aagcaggagt acaccagcct gctgtacatt       840
     ccgtcccagg ctccgtggga tatgtggaac cgcgatcata aacacggcct gaaactgtat       900
     gttcagcgtg tgttcatcat ggacgacgca gaacagttca tgccgaacta tctgcgcttc       960
     gtgcgtggtc tgattgactc cagcgatctg ccgctgaacg tttcccgtga aatcctccag      1020
     gacagcacgg taacgcgtaa cctgcgcaat gcgctgacca agcgtgtgct gcaaatgctg      1080
     gaaaaactgg cgaaagacga cgcggaaaaa taccagacct tctggcaaca gtttggcctg      1140
     gtactgaaag aaggtccggc ggaagatttc gctaaccagg aagcgatcgc caaattgctg      1200
     cgttttgctt ctacccatac cgattcttct gcgcagaccg tgtctctgga agactacgtt      1260
     tcccgcatga aagaagggca ggagaaaatc tactacatca ctgcagacag ctatgcggca      1320
     gcgaagagca gcccgcacct ggaactgctg cgtaagaaag gcatcgaagt tctgctgctt      1380
     tccgaccgca tcgatgagtg gatgatgaac tatctgactg agttcgacgg taaaccgttc      1440
     cagtcggtgt ctaaagttga cgagtcgctg gaaaaactgg ctgacgaagt tgatgagagc      1500
     gcgaaagaag cggagaaagc actgactccg ttcatcgacc gtgtgaaagc cctgctcggc      1560
     gagcgcgtga aagatgtccg tctgactcac cgtctgaccg atacgccagc gatcgtttcg      1620
     accgacgcgg acgaaatgag cactcagatg gcgaaactgt tcgctgcggc gggccagaaa      1680
     gtgccagaag tgaaatacat cttcgaactg aacccggatc acgtactggt gaaacgtgcg      1740
     gcagatactg aagatgaagc gaagttcagc gagtgggtag aactgctgct ggatcaggca      1800
     ctgctggcag aacgcggcac gctggaagat ccgaacctgt ttattcgtcg tatgaaccag      1860
     ctgctggttt cctga                                                       1875
//

If you have problems or comments...

PBIL Back to PBIL home page