(data stored in ACNUC7421 zone)

EMBL: BA000007.HTRE

BA000007.HTRE        Location/Qualifiers
FT   CDS_pept        complement(157242..159842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrE"
FT                   /locus_tag="ECs_0143"
FT                   /product="outer membrane usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33566"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33566"
FT                   /db_xref="GOA:A0A0H3JFB9"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JFB9"
FT                   /protein_id="BAB33566.1"
FT                   /translation="MYQFTHQKSRIPKKTLLAACCALFYSSNGAAADTVEYDSSFLMGT
FT                   GASTIDVKRYAQGNPTPPGLYNVRVFVNGQATSSLEIPFVDIGENSAAACLTHKNLAQL
FT                   HIKQPEQPVTLLAREGEEEDCLDLAKSYEKADVCFDGSDQFLDLTIPQAYVLKSYGGYV
FT                   DPSLWESGINAATLAYTLNAYHTSSDNDNSDSVYGAFNSGINLGAWHFRARGNYNWTTD
FT                   NGSDFDFQDRYLQRDIPAIRSQIIMGDAYTTGETFDSVNVRGVRLYSDSRMLPSALASY
FT                   APTIRGVANSNAKVTVTQSGYKIYETTVPPGEFVIDDISPSGFGSELVVTIEEADGSKR
FT                   TFTQPFSSVVQMQRPGVGRWDFSAGKVIDDSLRSEPNMGQASYYYGLNNLFTGYTGIQF
FT                   TDNNYLAGLLGVGINTSIGAFAVDVTHSRAEIPDDKTYQGQSYRVTWNKLFQDTGTSFN
FT                   LAAYRYSTQDYLGLHDALVLIDDAKHLSADEDKNTMQTYSRMKNQFTVSINQPLNIAYE
FT                   DYGSLFISGSWTYYWAANNSRTEYNVGYSKSVSWGSFSVNLQRSWNEDGEKDDAMYVSV
FT                   SVPIENILGGKRKSSGFRNLNTQLNTDFDGSHQLNVNSSGNTENNLVNYSVNAGYSLDK
FT                   NAGDLASVGGYLNYESGLGGISASASATSDNSQQYSISTDGGFVLHSGGLTFTNNSFSS
FT                   NDTLVLINALGAKGARINNSNNEIDRWGYAVTSSVSPYRENRVGLNIETLENDVELKST
FT                   SATTVPRSGSVVLTRFETDEGRSAVLNITAANGKSIPFAAEVYQGEVMIGSMGQGGQAF
FT                   VRGINDSGELIVRWYENNQTIDCKLHYQFPAQPQTQGSTNTLLLNNLTCQVANH"
     ttgtaccagt ttactcatca aaaaagccgt atcccgaaaa aaacgctact tgcggcctgt        60
     tgtgccctgt tttatagcag caacggtgct gcggcggaca ccgtggaata tgacagttcc       120
     tttttaatgg gaactggcgc atcaacgatt gatgttaaac gttatgctca aggcaacccg       180
     acaccgccgg gtctctataa tgtccgcgta tttgtaaacg gtcaggcgac ttccagctta       240
     gaaattccgt ttgtggatat tggcgaaaac agtgcggcgg cctgtcttac ccataaaaac       300
     ctggcgcaac ttcacattaa gcaacctgaa cagcctgtca ctttactcgc cagagaaggt       360
     gaagaagagg attgtctgga tctggcaaag tcatacgaaa aggcggatgt gtgctttgac       420
     ggtagtgacc agtttctcga tctgacgatc cctcaggcct atgttctgaa aagctatggc       480
     ggctacgttg acccttcttt atgggaatcg ggaattaacg ctgccacact ggcatatacc       540
     ctgaacgcgt atcacacaag ttcagataac gacaatagtg acagcgtcta tggcgcgttc       600
     aactcaggta tcaatttagg agcctggcac tttcgtgcgc gcggtaacta taactggaca       660
     acagataacg gcagcgattt cgatttccag gatcgttact tacagcgtga cattccggca       720
     atccgttccc agataattat gggtgatgcc tataccaccg gtgaaacgtt tgactctgtc       780
     aacgtccgtg gtgttcgcct gtacagcgac agccgtatgc tgccttcggc gctggccagt       840
     tacgctccga ccatccgcgg tgtagcaaac tccaacgcca aagtcaccgt gacgcaaagc       900
     ggatataaaa tttatgaaac caccgttccg cccggtgaat ttgttataga cgacattagc       960
     ccttccggct ttggtagcga actggtcgtg accattgaag aagcggatgg ttccaaacgc      1020
     acctttacgc aacccttctc gtcggttgta caaatgcaac gtcctggtgt gggccgttgg      1080
     gatttcagcg cgggtaaagt cattgatgac agtctgcgat ccgaacccaa tatggggcaa      1140
     gcctcttatt actatggtct gaataacctc ttcacgggtt ataccggcat tcagttcacc      1200
     gataataact atcttgccgg gctgttaggt gtgggtatca acaccagcat cggcgccttt      1260
     gcggtagacg ttacccattc ccgtgctgaa attccggatg ataaaaccta ccaggggcaa      1320
     agttatcgcg tgacctggaa caaacttttc caggataccg ggacatcatt taacctcgcg      1380
     gcgtaccgct attccaccca ggattacctg ggcctgcatg atgcgttagt cctcattgac      1440
     gacgccaagc atttgtctgc cgatgaagac aaaaacacca tgcagacgta ctcacgtatg      1500
     aaaaaccagt ttaccgtcag cattaaccag ccattgaata tcgcctatga agattacggt      1560
     tcgctgttta tttccggtag ctggacgtat tactgggcgg cgaacaatag ccgcactgaa      1620
     tataatgttg gttacagtaa aagcgtttcg tggggcagtt tcagcgtcaa cctacaacgt      1680
     agctggaatg aagacggcga gaaagatgac gcgatgtacg tcagcgttag cgtacctatt      1740
     gagaatattt taggtggcaa acgtaagtct tctggtttcc gcaatttaaa tactcagctc      1800
     aataccgatt tcgatggttc acatcagttg aatgttaaca gttccggtaa cactgaaaac      1860
     aatctggtga actacagtgt caacgcaggt tatagcctcg ataaaaacgc cggcgattta      1920
     gcctctgttg gtggttatct caactatgaa tctgggttag gcggtatttc cgcttcggcc      1980
     tcggccactt ctgataacag ccaacagtac tccatctcaa ccgatggcgg ctttgtatta      2040
     cacagtggtg gtttaacgtt cactaacaac agtttcagca gtaacgacac gctggtgtta      2100
     atcaacgccc taggtgctaa aggcgcacga atcaataaca gtaataacga aatcgatcgc      2160
     tggggatatg ccgtgacgtc ctctgtcagc ccatatcgtg aaaaccgggt aggtctgaac      2220
     attgaaacac tggaaaacga tgttgaactg aaaagtacca gcgccaccac cgtaccacgt      2280
     agcggctccg ttgttttgac ccgtttcgaa actgacgagg ggcgttctgc cgtgctgaat      2340
     attactgccg ccaatggcaa atccattccg tttgctgcgg aggtttacca gggtgaggtg      2400
     atgatcggca gcatgggcca gggtggtcag gcatttgtac gcggtattaa cgacagcggg      2460
     gaattaatcg tgcgctggta tgaaaacaac caaaccattg actgtaagtt gcactaccag      2520
     ttcccggcgc agccacaaac gcagggaagc accaacacct tattacttaa caatcttacc      2580
     tgtcaggtag caaatcacta a                                                2601
//

If you have problems or comments...

PBIL Back to PBIL home page