(data stored in ACNUC7421 zone)

EMBL: BA000007.HYXA

BA000007.HYXA        Location/Qualifiers
FT   CDS_pept        complement(369563..370324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hyxA"
FT                   /locus_tag="ECs_0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33774"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33774"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6D5"
FT                   /protein_id="BAB33774.1"
FT                   /translation="MRFVLFCPSGIVPAQFAALSTGSVGNVTCIGTEEELRNKLRHRPQ
FT                   SVVISAGRPAECAEMWFRFYRDHSFVVVLCVAPFFLPPDVSISGVLKNLRLLKPGMSVE
FT                   HVISIANSSGGLSGLKHAENLPVMDSYSVFMKEVNNRTKTIVMSERFPEKQKKVLSLLL
FT                   AGHSWEYSAQFLKTGIRQIWLAEQSLKKRWGIPDSMSLREALLLSSNKFHGDGNALEKT
FT                   NAMTLRENGNTNRYSVVVNAGTQVLSLHKYK"
     atgcgtttcg ttcttttctg tccctcagga attgtaccag cgcagttcgc agctctatca        60
     accggttctg tcggcaatgt tacctgcatc ggaacagaag aggagttacg caataaattg       120
     cggcacaggc cacagagtgt cgtgatatcg gcagggcgac ctgccgaatg cgctgaaatg       180
     tggttccgat tttatcggga tcactcattc gtggtggtgt tgtgcgtcgc gccatttttt       240
     ctgccaccgg atgtgagtat ttctggcgtt ctcaaaaacc tgaggttact gaaaccagga       300
     atgtcagtag agcatgtcat cagtattgca aattcctctg gtgggttatc agggctgaaa       360
     catgcagaaa atttgccagt tatggacagt tactctgtct ttatgaaaga ggtgaataac       420
     cgcacaaaga caatcgtcat gtcagaacgc ttcccggaaa agcaaaagaa ggtgttgtcg       480
     ttgcttcttg ccggacacag ctgggaatac agtgcgcagt ttctcaaaac ggggataaga       540
     cagatatggc ttgccgagca gtcgctaaaa aagcgttggg gaataccgga cagcatgtca       600
     ttgcgggaag ccctgctgct gagcagcaat aaatttcacg gtgatggaaa tgcattggaa       660
     aaaacgaatg ccatgacatt gcgtgaaaac ggaaatacca acaggtattc cgtggtggta       720
     aatgcaggga cgcaggtttt atctctgcat aaatataaat aa                          762
//

If you have problems or comments...

PBIL Back to PBIL home page