(data stored in ACNUC7421 zone)

EMBL: BA000007.HYXR

BA000007.HYXR        Location/Qualifiers
FT   CDS_pept        complement(371105..371272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hyxR"
FT                   /locus_tag="ECs_0352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33775"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33775"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JBV2"
FT                   /protein_id="BAB33775.2"
FT                   /translation="MKKPLVIISACQFTRLALESLIPADRYIVRVYSNVTTEVEFVLKT
FT                   SCGYLLADIP"
     atgaagaagc ctctggttat tatcagtgcc tgtcagttta ccaggctggc actggagtct        60
     ctcatcccag cggacaggta tatcgtgcgg gtgtacagca acgtcactac agaggttgaa       120
     ttcgttttaa agacctcctg tggctatctg ttggctgata tcccttag                    168
//

If you have problems or comments...

PBIL Back to PBIL home page