(data stored in ACNUC7421 zone)

EMBL: BA000007.ILVH

BA000007.ILVH        Location/Qualifiers
FT   CDS_pept        91963..92454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /locus_tag="ECs_0082"
FT                   /product="acetolactate synthase 3 small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33505"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33505"
FT                   /db_xref="GOA:Q8X9Z5"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X9Z5"
FT                   /protein_id="BAB33505.1"
FT                   /translation="MRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLSR
FT                   MTIQTVGDEKVLEQIEKQLYKLVDVLRVSELGQGAHVEREIMLVKIQASGYGRDEVKRN
FT                   TEIFRGQIIDVTPSLYTVQLAGTSDKLDAFLASIRDVAKIVEVARSGVVGLSRGDKIMR
FT                   "
     atgcgccgga tattatcagt cttactcgaa aatgaatcag gcgcgttatc ccgcgtgatt        60
     ggcctttttt cccagcgtgg ctacaacatt gaaagcctga ccgttgcgcc aaccgacgat       120
     ccgacattat cgcgtatgac catccagacc gtgggcgatg aaaaagtgct tgagcagatc       180
     gaaaagcaat tatacaagct ggtcgatgtc ttgcgcgtga gtgagttggg gcagggcgcg       240
     catgttgaga gggaaatcat gctggtgaaa attcaggcca gcggttacgg gcgtgacgaa       300
     gttaaacgta atacggaaat attccgtggg caaattattg atgtcacacc ctcgctttat       360
     accgttcaat tagcaggcac cagcgataag cttgatgcat ttttagcatc gattcgcgat       420
     gtggcgaaaa ttgtggaagt tgctcgctct ggtgtggtcg gactttcgcg cggcgataaa       480
     ataatgcgtt ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page