(data stored in ACNUC7421 zone)

EMBL: BA000007.ILVI

BA000007.ILVI        Location/Qualifiers
FT   CDS_pept        90236..91960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvI"
FT                   /locus_tag="ECs_0081"
FT                   /product="acetolactate synthase 3 large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33504"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33504"
FT                   /db_xref="GOA:A0A0H3JBR8"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JBR8"
FT                   /protein_id="BAB33504.2"
FT                   /translation="MEMLSGAEMVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGIGH
FT                   VLVRHEQAAVHMADGLARATGEVGVVLVTSGPGATNAITGIATAYMDSIPLVVLSGQVA
FT                   TSLIGYDAFQECDMVGISRPVVKHSFLVKQTEDIPQVLKKAFWLAASGRPGPVVVDLPK
FT                   DILNPANKLPYVWPESVSMRSYNPTTTGHKGQIKRALQTLVAAKKPVVYVGGGAITAGC
FT                   HQQLKETVEALNLPVVSSLMGLGAFPATHRQALGMLGMHGTYEANMTMHNADVIFAVGV
FT                   RFDDRTTNNLAKYCPNATVLHIDIDPTSISKTVTADIPIVGDARQVLEQMLELLSQESA
FT                   HQPLDEIRDWWQQIEQWRARQCLKYDTHSEKIKPQAVIETLWRLTKGGAYVTSDVGQHQ
FT                   MFAALYYPFDKPRRWINSGGLGTMGFGLPAALGVKMALPEETVVCVTGDGSIQMNIQEL
FT                   STALQYELPVLVVNLNNRYLGMVKQWQDMIYSGRHSQSYMQSLPDFVRLAEAYGHVGIQ
FT                   ISHPQELESKLSEALEQVRNNRLVFVDVTVDGSEHVYPMQIRGGGMDEMWLSKTERT"
     atggagatgt tgtctggagc cgagatggtc gtccgatcgc ttatcgatca gggcgttaaa        60
     caagtattcg gttatcccgg aggcgcagtc cttgatattt acgatgcatt gcataccgtg       120
     ggtggtatcg gtcatgtttt agttcgtcat gagcaggcgg cagtgcatat ggccgatggt       180
     ctggcgcgcg cgaccgggga agtcggcgtc gtgctggtaa cgtcgggtcc aggggcgacc       240
     aatgcgatta ccggcatcgc caccgcttat atggattcca ttccattagt tgtcctttcc       300
     gggcaggtag cgacctcgtt gataggttac gatgcctttc aggagtgcga catggtgggg       360
     atttcgcgac cggtggttaa acacagtttt ctggttaagc aaacggaaga cattccgcag       420
     gtgctgaaaa aggctttctg gctggcggca agtggtcgcc caggaccagt ggtcgttgat       480
     ttaccgaaag atattcttaa tccggcgaac aaattaccct atgtctggcc ggagtcggtc       540
     agtatgcgtt cttacaatcc cactactacc ggacataaag ggcaaattaa gcgcgctctg       600
     caaacgctgg tggcggcaaa aaaaccggtt gtctacgtag gcggtggggc aatcacggcg       660
     ggctgccatc aacagctgaa agaaacggtg gaggcgttaa atctgcccgt tgtttcctca       720
     ttgatggggc tgggagcgtt tccggcaacg catcgtcagg cactgggcat gctgggaatg       780
     cacggtacct acgaagccaa tatgacgatg cataacgcgg atgtgatttt tgctgtcggt       840
     gtccgctttg acgatcgcac cactaacaat ctggcaaagt actgcccaaa tgccactgtt       900
     ctgcatatcg atattgatcc tacttccatt tctaaaaccg tgactgcgga tattccgatt       960
     gtgggggatg ctcgccaggt cctcgaacaa atgcttgaac tcttgtcgca agaatccgcc      1020
     catcaaccgc tggatgagat ccgcgactgg tggcagcaga ttgaacagtg gcgcgctcgt      1080
     cagtgcctga aatatgacac tcacagtgaa aagattaaac cgcaggcggt gatcgagact      1140
     ctttggcggt tgacgaaggg gggcgcttac gttacgtccg atgtcgggca gcaccagatg      1200
     tttgctgcgc tttattatcc attcgacaaa ccccgtcgtt ggatcaactc cggtggcctc      1260
     ggcactatgg gctttggttt acctgcggca ctgggcgtca aaatggcgct gccagaagaa      1320
     accgtggttt gcgtcactgg cgacggcagt attcagatga acattcagga actgtctaca      1380
     gcgttgcaat atgaactgcc ggtgctggtg gttaatctta ataaccgcta tttggggatg      1440
     gtgaagcagt ggcaggacat gatctattcc ggtcgtcatt cacaatctta tatgcagtct      1500
     ttaccagact tcgtccgtct ggcggaagcc tatggtcacg tcgggatcca gatctctcat      1560
     ccgcaagagc tggaaagcaa acttagcgag gcgcttgaac aggtgcgtaa taatcgcctg      1620
     gtatttgttg atgtcaccgt cgatggcagt gagcacgtct acccgatgca gattcgcggg      1680
     ggcggaatgg atgaaatgtg gttaagcaaa acggagagaa cctga                      1725
//

If you have problems or comments...

PBIL Back to PBIL home page