(data stored in ACNUC7421 zone)

EMBL: BA000007.IMP

BA000007.IMP         Location/Qualifiers
FT   CDS_pept        complement(256527..257807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="imp"
FT                   /locus_tag="ECs_0227"
FT                   /product="type VI secretion system protein ImpI"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33650"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33650"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR017735"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152V9Q1"
FT                   /protein_id="BAB33650.1"
FT                   /translation="MPEEKLQTLSLQVINGSELESGRAARCLFTQQGNVGHAPECHWSV
FT                   QDRQQSIPAQAFTVILHDGTFCLRPQTAQLWLNQAKVTATSDLIQLRQGDEIQIGRLMV
FT                   RVHLNRGDIPHYDEEMATPETIVTNRDMLTDTLLSTEGAPHYPGMTHRHQLADTVVNGF
FT                   SADPLQALQSESLITTGDPLSGIAAVRPSAPLSDPASNGGINTPFMDLPPIYASPGDHN
FT                   DDISAAEMAQRHLAVTPLLRGLGGSLTVSNSDDADDFLEEAGRTLQAAIKGLLDLQQQR
FT                   NSLSDKHLRPLEDNPLRLNMDYATALDVMFAEGKSPVHLAAPAAVSESLRNVRHHEEAN
FT                   RAAIVESLRVLLDAFSPQNLLRRFVQYRRSHELRQPLDDAGAWQMYSHYYEELASDRQQ
FT                   GFEMLFNEVYAQVYDRVLREKQREPEA"
     atgccggaag agaaactaca gacgctttca ttgcaggtca ttaacggcag tgagctggaa        60
     agcgggcggg cggcgcgctg tctgttcaca cagcagggaa atgtcggcca tgcccccgaa       120
     tgccactggt cggtacagga tcgtcagcag agcattccgg cccaggcttt taccgttatc       180
     ctgcacgatg gcacattttg tctacgcccg cagacggcac aactgtggct gaatcaggca       240
     aaagtcacag caacatcaga cctgatacag ttgcgccagg gcgatgagat ccagatcgga       300
     cggctgatgg tgagggttca tctgaaccgg ggagatattc cccattacga tgaggaaatg       360
     gccactcccg aaaccatcgt taccaatcgc gatatgctca cggataccct gctatcaacg       420
     gagggtgcgc cacactatcc gggaatgact caccggcacc agcttgcaga caccgtggta       480
     aatggttttt ctgccgatcc actccaggca cttcagtccg aaagcctgat taccacgggc       540
     gatccgcttt caggcattgc ggctgtccgg ccatcggcac cgctgtccga tccggcaagt       600
     aatgggggga tcaatactcc gtttatggat ctgccgccca tttatgccag ccctggcgat       660
     cataatgatg acatctctgc ggcagaaatg gcgcaacgcc accttgcggt caccccctta       720
     ctgcgcggtc ttggcggctc gcttaccgtg agcaattccg acgatgcgga tgattttctg       780
     gaggaggccg gacgaacgtt acaggccgca ataaaaggtc tgctcgattt gcagcagcag       840
     cgtaacagcc tctcagacaa acatttgcgc ccgctggaag ataacccgct gcgcctgaac       900
     atggattacg ccaccgcgct cgacgtgatg tttgccgaag gtaaaagccc ggtacatctg       960
     gcggctcccg ccgccgtcag tgaaagcctg cgcaatgtcc gccaccacga agaagctaac      1020
     cgggcggcga ttgtggagtc gcttcgtgtc ctgctggatg ctttctcacc acaaaatctg      1080
     ctgcgccgct ttgtgcagta ccgccgcagc catgaactgc gccagccgct ggatgatgcc      1140
     ggagcatggc aaatgtacag ccattattac gaagaactgg cctccgatcg ccagcagggg      1200
     tttgagatgc tgtttaacga ggtctacgcc caggtctatg accgggtgct tcgtgaaaaa      1260
     cagcgggagc cggaagcatg a                                                1281
//

If you have problems or comments...

PBIL Back to PBIL home page