(data stored in ACNUC7421 zone)

EMBL: BA000007.IMPB

BA000007.IMPB        Location/Qualifiers
FT   CDS_pept        complement(262937..263437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="impB"
FT                   /locus_tag="ECs_0233"
FT                   /product="type VI secretion system protein ImpB"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33656"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33656"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7T5"
FT                   /protein_id="BAB33656.1"
FT                   /translation="MSKKFEGSVAPRERINISYVPKTDGQTAEVELPLNMLVVGDTGNT
FT                   QETSSLDERQAVSVNKHNFGAVMAEAAIGLNFTVPATLKGSTTDDEMNVALNIKSLDDF
FT                   SPDSVARQVPEVNKLLELREALTALKGPMGNLPAFRTQLQALLENEESREQLLKEIGQV
FT                   SNK"
     atgagcaaaa aatttgaagg cagcgtcgcg cctcgcgaac gtattaatat atcgtatgtc        60
     ccaaaaacag atggccagac ggctgaagtg gaacttccgc ttaacatgct cgttgtcggc       120
     gataccggaa atacgcagga aacatcctca ctggatgaac gtcaggcagt ttccgttaac       180
     aagcacaatt tcggtgcagt gatggctgaa gcagccattg gcctcaattt taccgtcccc       240
     gccacgctga agggaagcac aacggacgat gaaatgaatg tggcgctgaa tatcaagtca       300
     ctggatgatt tttcaccaga tagcgtggcc cggcaggttc cggaagtgaa taaattgctg       360
     gaactgcgtg aagcactgac tgcactgaag gggccgatgg gtaaccttcc ggcattccgt       420
     acccagctcc aggcattgct ggaaaatgaa gagtcccgcg agcagttgct caaagaaatc       480
     ggccaggtga gcaataaata a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page