(data stored in ACNUC7421 zone)

EMBL: BA000007.IMPC

BA000007.IMPC        Location/Qualifiers
FT   CDS_pept        complement(261236..262627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="impC"
FT                   /locus_tag="ECs_0231"
FT                   /product="type VI secretion system protein ImpC"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33654"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33654"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7T9"
FT                   /protein_id="BAB33654.1"
FT                   /translation="MSLQEEELVSSHAGQPEQESSLLDQIMAQTRIQPGSEGYDVARQG
FT                   VTAFIASILQSTASAEPVNKLAVDSMIADIDERISRQMDVIIHAPAFQQVESFWRSLKT
FT                   MVDRVDFRENIKVNVLHVTKQELLEDFEFAPEIIQSGFYKHVYSSGFGQFGGEPIAAVL
FT                   GAYEFKNTAPDMKLLQYVSAVGAMAHAPFLSSVSPEFMGLNSWTELPNIKDLYAIFEGP
FT                   AYTKWRALRDSEDSRYLGLTAPRFLLRQPYSPTDNPVKNFNYYEDVSQNHEDYLWGNTA
FT                   WMLACNIADSFAKYRWCPNIIGPQSGGAVKDLPVHLFETMGQIQAKIPTEVLVTDRREF
FT                   ELAEEGFITLTMRKDSDNAAFFSANSVQKPKHFPGKDAETNYKLGTQLPYLFIINRLAH
FT                   YIKVLQREQLGSWKERSDLERELNTWIRQYVADQENPPADVRSRKPLRAAKVEVMDVEG
FT                   EPGWY"
     atgtctttac aggaagagga actcgtttcc agtcatgccg ggcagcctga gcaggaatcg        60
     tcgctgcttg atcaaatcat ggcacagacc cgtattcagc ccggttcgga aggttatgac       120
     gttgcccgcc agggtgtgac agcctttatt gccagcatcc tgcaatccac tgcatctgcc       180
     gaaccggtca ataaactggc cgtggacagc atgattgcag atattgatga acgcatcagc       240
     cgccagatgg atgtcatcat ccatgcgcct gcctttcagc aggtcgagtc gttctggcgc       300
     tcactgaaaa ccatggtgga tcgcgttgat ttccgtgaaa acatcaaggt caacgtgctt       360
     catgtcacca agcaggaact tctggaagac tttgagtttg cgccagaaat tattcagtcc       420
     ggattttata agcacgttta ttcgtccggt ttcggacagt ttggcggtga acccatcgct       480
     gccgtgctgg gcgcttatga gttcaaaaat accgcgcctg acatgaaact gctgcaatac       540
     gtcagtgccg tgggcgcaat ggcgcacgca ccgttcctgt cctccgtttc cccggagttt       600
     atggggctga actcgtggac cgaactgcct aatatcaaag atctttatgc catctttgaa       660
     ggtccggcct acaccaaatg gcgcgccctg cgtgactcgg aagattcgcg ctatttaggg       720
     cttacggcac cccgcttcct gcttcgccag ccctattcac caacagataa ccctgttaag       780
     aactttaact attacgaaga tgtcagccag aaccacgaag attatctgtg gggtaatacg       840
     gcctggatgc tggcatgcaa tatcgcagac agttttgcca aataccgctg gtgtccaaac       900
     attatcggtc cgcaaagcgg cggcgcagtg aaagatctgc cggtgcatct gttcgaaacg       960
     atggggcaga ttcaggccaa aatcccaacc gaggtgctgg tcaccgatcg ccgcgaattt      1020
     gaactggctg aagagggttt tatcaccctt accatgcgta aagactctga taatgcagcc      1080
     tttttctctg caaactcggt acaaaaaccg aagcactttc cgggaaaaga tgcagaaacc      1140
     aactataagc tgggtacgca gcttccttat ctcttcatca tcaatcggtt agcgcactac      1200
     atcaaggtgt tgcagcgtga acaactgggg tcatggaaag aaaggagcga cttagaaaga      1260
     gagcttaata cctggatccg tcagtatgtt gccgaccagg aaaacccgcc tgcagacgtg      1320
     cgcagccgca aacctctgcg cgctgccaaa gttgaggtta tggatgtaga aggcgaaccc      1380
     ggctggtact ag                                                          1392
//

If you have problems or comments...

PBIL Back to PBIL home page