(data stored in ACNUC7421 zone)

EMBL: BA000007.IMPH

BA000007.IMPH        Location/Qualifiers
FT   CDS_pept        complement(257832..258914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="impH"
FT                   /locus_tag="ECs_0228"
FT                   /product="type VI secretion system protein ImpH"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33651"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33651"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7U7"
FT                   /protein_id="BAB33651.1"
FT                   /translation="MDGKNRAASSYLSPGNPPADKEQNDPLAQVFHNACSYNFFAMAEL
FT                   LHRLAKGEKGTPELSLRDDPAQETLRFSADASLAFPCSDISALKRDTSGAFRMTTTFMG
FT                   LQGSQSPLPGYYLDHLAWKAVHEQSPVGDFLDMFSHRLTQFVWHIWRKYRYHISFRNGG
FT                   VDAFSQRMYSLVGLGHRQLRDKLAINHSKMLAYSGILANPGRSPEIICGLVSHCFDLSE
FT                   VTLQNWQRRKVDIEPDQQNSLGSYSLKNGEKLAGRSVLGNFVLGTRVPDLSGKFQLSIT
FT                   SLTRKQFLSFLPSGENFLPLTTFVSFILRDQLAWDLHLGLAPEQVGAMRLGDNKSALLG
FT                   WTSFLGTPEERPSVTIRVRS"
     atggacggaa agaatcgggc agcatcctct tatctgagtc cgggaaatcc cccggcagat        60
     aaagagcaga atgatccgct ggcacaggtt ttccataatg cctgctctta caattttttt       120
     gcgatggcgg agctgttgca ccgcctggca aagggtgaaa aggggacgcc agaattatcc       180
     ctgcgcgacg atccggcaca ggaaaccctg cgtttcagcg ccgatgccag ccttgccttc       240
     ccgtgcagtg atatcagtgc gctgaaacgg gatacgtcag gggcattcag gatgaccact       300
     acctttatgg ggttacaggg gagccagtcg cctctccccg gttattacct cgatcacctg       360
     gcctggaaag cggtacatga acaaagtccg gtaggtgatt ttctggatat gttcagccac       420
     cgcctgaccc agtttgtctg gcatatctgg cgtaagtacc gctatcacat cagttttcgt       480
     aacggcggtg tggatgcgtt ctcgcagcgc atgtactccc ttgtcgggct gggccaccgc       540
     cagcttcgcg ataagctggc gattaatcac agcaaaatgc tggcgtattc cgggatcctg       600
     gcaaatccgg gacgatcccc ggaaattatc tgtggcctgg tgtcccactg ctttgatttg       660
     tcagaagtga cgctgcaaaa ctggcaacgt cgcaaggtgg atattgaacc ggatcagcaa       720
     aacagcctgg ggagctattc tcttaaaaat ggcgaaaaac tggcgggaag atcggtactg       780
     ggcaactttg ttctgggtac acgagtaccc gatctcagcg gaaaattcca gctcagtatt       840
     accagcctga cccgaaaaca gttcctctct tttctgccgt ccggcgaaaa cttcctgcca       900
     ctgacgacgt tcgtgtcctt catcctgcgc gatcagcttg cctgggactt acatctgggg       960
     ctggcgccgg agcaggtggg cgcaatgcgc ctgggcgata acaaaagtgc gctgctgggc      1020
     tggaccagct tcctcggcac accggaagaa cgaccctcag tcaccatcag ggtacggtcg      1080
     taa                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page