(data stored in ACNUC7421 zone)

EMBL: BA000007.IMPJ

BA000007.IMPJ        Location/Qualifiers
FT   CDS_pept        complement(254672..256003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="impJ"
FT                   /locus_tag="ECs_0225"
FT                   /product="type VI secretion system protein ImpJ"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33648"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33648"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7V2"
FT                   /protein_id="BAB33648.1"
FT                   /translation="MATTRNKVMWQEGMLMRPHHFQQQQRYNDYLDNQRFRAMNDLSWG
FT                   FTELTLNNELLAQGKIMIDSASGTLPDGTVFSIPDQDALPDPLHPQNFPDERSRNIYLA
FT                   LPVASDVRNEISDGRRIGRYRLNYADVRDLHSEEGDARTLTLGQLTPRIMSGAEDMSAY
FT                   ITLPLCRISDRHADGSLTLDDDFIPSCQNIQVSKKLRVYLKEVQGAIGGRASDLANRIG
FT                   SPAQSGIADVAEFMMLQLLNRNQTRFTHRARRSQLHPEDFYLDLAELLGELMTFTEPSR
FT                   LPCPLDVYDHHDLTKTFKTLLPEVKRALHTVLSPRAVNLPLHLRDGIWQADVHDSELLQ
FT                   SATFVLAVAANMPVDQIQRQFIQQSKISSPEKIRNMVSVQIPGIPLRALMVAPRQLPYH
FT                   SGFSYFELDKSGQAWTEMAAAGAVALHVSGSFPDLNMQLWAIRG"
     atggcaacca cccgcaacaa ggtgatgtgg caggaaggga tgctgatgcg cccacaccat        60
     ttccagcaac agcagcgtta caacgactac ctggataacc agcgtttccg ggccatgaat       120
     gatttatcct ggggatttac cgaactcacc ctcaacaatg aactgctggc gcagggtaag       180
     atcatgattg acagcgcgtc aggcacactg cctgacggca ccgtcttttc tatccccgac       240
     caggacgcac tgcccgatcc gctgcacccg caaaattttc cggacgaaag aagccgcaat       300
     atttacctcg ctctgccggt cgccagtgat gtgagaaatg aaatcagcga cgggcggcga       360
     atcgggcgtt accggctgaa ttatgccgat gtccgggatc tgcattcaga agaaggcgac       420
     gcgcgaacac tgacgctggg acaactgacg ccgcgcatta tgagcggtgc agaagatatg       480
     agtgcctata ttacgctccc gctttgccgt atcagcgatc gccatgccga cggctccctg       540
     acgctggatg acgattttat cccctcctgc cagaatattc aggtcagtaa gaaactgcgt       600
     gtttatctca aagaggtaca gggggccatt ggcggacggg caagcgatct ggcaaaccgt       660
     attggctctc cggcgcagag cggcatcgcg gatgtggcgg aatttatgat gttgcagttg       720
     cttaaccgta accagacccg gtttacccat cgcgcccgcc gatcccagct ccacccggaa       780
     gatttctacc ttgatcttgc cgagttgctg ggtgaactga tgacctttac agagccgtca       840
     cgcctgccct gcccgcttga tgtgtatgat catcatgacc tgaccaaaac atttaaaaca       900
     ctgttaccgg aagtcaaacg ggcgctgcat accgtactgt cgccaagagc ggtcaatctg       960
     ccgctgcatc tgcgtgacgg catctggcag gccgatgttc atgactcgga actgctacag      1020
     tctgccacct ttgtactggc cgtggcagca aatatgcctg tcgatcagat ccagcgtcag      1080
     tttatccagc agtcgaaaat ttcctcgccg gaaaaaatcc gcaatatggt cagtgtgcag      1140
     atcccgggta ttcctctgcg cgcactgatg gtggcccccc gccagcttcc ctaccattcc      1200
     gggttcagct atttcgaact cgacaagagc ggccaggcct ggacagaaat ggctgccgcc      1260
     ggggccgttg cactgcatgt atccggcagt ttcccggatc tgaacatgca actgtgggcg      1320
     ataagagggt aa                                                          1332
//

If you have problems or comments...

PBIL Back to PBIL home page