(data stored in ACNUC7421 zone)

EMBL: BA000007.IMPK

BA000007.IMPK        Location/Qualifiers
FT   CDS_pept        complement(253906..254667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="impK"
FT                   /locus_tag="ECs_0224"
FT                   /product="type VI secretion system protein ImpK"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33647"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33647"
FT                   /db_xref="GOA:Q8X7V4"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7V4"
FT                   /protein_id="BAB33647.1"
FT                   /translation="MDEGSLSLPPFTGYDEKSLRDYHLALHGNSLNPMIDAATPLLGMV
FT                   MRLSTMNSQTMPEHLFAQVVTDVQAVEQLLQEQGYEPGVIISFRYILCTFIDEAALGNG
FT                   WSNKNEWIKQSLLVHFHNEAWGGEKVFILLERLIREPKRYQDLLEFLWLCFSLGFRGRY
FT                   KVAVQDQGEFEQIYRRLYHVLHKLRGDAPFPLLHQDKKTQGGRYQLISRLTVKHIFCGG
FT                   VVVLALFYLFYLLRLDSQTQDILHQLNKLLR"
     atggatgagg ggtcactgtc tctgccacca tttaccggat acgacgaaaa aagcctgcgc        60
     gactaccatc tcgcgcttca tggcaacagc ctgaatccga tgatcgacgc ggcgacgccg       120
     ctactcggta tggtaatgcg cctttccacc atgaacagcc agacgatgcc ggagcatctt       180
     tttgctcagg tggtgacaga tgttcaggcc gtggagcaac tgcttcagga acagggctac       240
     gaaccgggcg tgattatctc gtttcgctac atcctctgca cgtttattga tgaagcggcg       300
     ctcggtaacg gctggtcgaa caagaacgag tggatcaagc agtcattgct ggtccatttc       360
     cacaacgaag cctggggtgg cgagaaagtt ttcatcctgc tggagcgcct gatccgtgaa       420
     cccaaacgtt accaggatct gctggaattt ctctggctct gtttttctct gggatttcgc       480
     gggcgctaca aagtggcagt acaggatcag ggggaatttg agcagatcta ccgccgtctg       540
     taccacgttc tgcataaact gcgcggcgat gcccctttcc cgctgttaca ccaggacaaa       600
     aaaacccaag gcgggcgtta tcagctcatc agtcgcctga ctgttaaaca tattttttgt       660
     ggtggcgttg tcgtgctggc gttgttttac ctgttctatc tgttgcggct ggacagccag       720
     acgcaggaca tcctgcacca gctaaacaaa ttacttcgat aa                          762
//

If you have problems or comments...

PBIL Back to PBIL home page