(data stored in ACNUC7421 zone)

EMBL: BA000007.IMPL

BA000007.IMPL        Location/Qualifiers
FT   CDS_pept        complement(245399..248833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="impL"
FT                   /locus_tag="ECs_0218"
FT                   /product="type VI secretion system protein ImpL"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33641"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33641"
FT                   /db_xref="GOA:A0A0H3JDE0"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JDE0"
FT                   /protein_id="BAB33641.2"
FT                   /translation="MLILAWIFLLVWIWWKGPTWTLYEEQWLKPLANRWLATAAWGIIA
FT                   LVWLTVRVMKRLQLLEKQQKQQREEAIDPLSVELNAQQRYLDRWLLRLQRHLDNRRFLW
FT                   QLPWYMVIGPAGSGKTTLLREGFPSDIIYAPEGARGTEQRLYLTPHVGKQAVIFDIDGT
FT                   LCAPADADILHRRLWEHALGWLKEKRARQPLNGIILTLDLPDLLTADKRHREHLLQTLR
FT                   SRLQDIRQHLHCQLPVYVVLTRLDLLQGFAALFQSLNRQDRDAILGVTFTRRAHENDDW
FT                   RTELNAFWQTWVDRMNLALPDLMVTQTHTRASLFSFSRQMQGSREPLVSLLEGLLDGEN
FT                   MNVMLRGVYLTSSLQRGQMDDIFTQSAARQYRLGNNPLASWPLVDTAPYFTRSLFPQAL
FT                   LAEPNLATESRAWLMRSRRRLTVFSATGGVAALLLITGWHHYYNGNYQSGITVLKQAKA
FT                   FMDVPPPQGEDDYGNLQLPLLNPVRDATLAYGDWGDRSRLADMGLYQGRRIGPYVEQTY
FT                   LQLLEQRYLPSLFNGLVKAMNAAPPESEEKLAVLRVMRMLEDKSGRNNEVVKQYMAKRW
FT                   SEKFHGQRDIQAQLMSHLDYALAHTDWHAERQAGDGDAISRWTPYDKPVVSAQKELSKL
FT                   PVYQRVYQSLKTRALGVLPADLNLRDQVGPTFDQVFTSADDNKLVVPQFLTRYGLQSYF
FT                   VKQRDELVELTAMDSWVLNLTRSVKYSDADRAEIQRQLTEQYISDYTATWRAGMDNLNI
FT                   RNFESIGQLTGALEQVISGDQPLQRALTVLRDNTQPGVFSEKLSAKERDEALAEPDYQL
FT                   LTRLGHEFAPENITLAVQKDKESTMQAVYQQLTELHRYLLAIQNAPVPGKSALKAVQLR
FT                   LDQNSSDPIFATRQMAKTLPAPLNRWVGRLTDQAWHVVMVEAVHYMEVDWRDSVVKPFN
FT                   EQLANNYPFNPRSAQDASLDAFERFFKPDGILDTFYQQNLKLFIDNDLSLEDGDNNVII
FT                   REDIIAQLETAQKIRDIFFSKQNGLGTSFAVETVSLSGNKRRSVLNLDGQLVDYSQGRN
FT                   YTAHLVWPNNMREGNESKLTLIGTSGNAPRSISFSGPWAQFRLFGAGQLTGVQDGNFTV
FT                   RFSVDGGAMTYRVHTDTEDNPFSGGLFSQFGLSDTLY"
     ttgctgatac tggcgtggat ttttctgctg gtatggatct ggtggaaagg cccgacgtgg        60
     acgctgtatg aagaacagtg gctcaaacca ctggcgaacc gctggctggc aacggcggcg       120
     tgggggatta ttgccctggt gtggcttacc gtccgggtaa tgaagcgcct gcaactgctt       180
     gaaaaacagc aaaaacagca gcgcgaagag gccattgatc cgctcagtgt ggagctgaac       240
     gcccagcagc gttaccttga ccgctggctg ctgcgcctgc aacgccatct cgacaaccgc       300
     cgtttcctgt ggcagttacc gtggtatatg gtcatcggcc cggcgggcag tggcaaaacg       360
     acactgctgc gcgaggggtt tccgtcagac attatttatg ccccggaggg cgcgcgcggc       420
     acagaacaac gcctgtacct tacgccccat gtcggtaaac aggcggtgat ctttgatatc       480
     gacggcacac tctgcgctcc cgctgatgcg gatatcctgc atcgccgtct gtgggaacat       540
     gccctcggct ggctgaaaga aaagcgcgcg cgccagccgc tgaacgggat tattctgaca       600
     ctcgatttac ccgatctgct gaccgcagac aaacgccacc gcgagcatct gttacagacg       660
     ctgcgcagcc gcttacagga tatacgccag catcttcact gccagttacc ggtttacgtg       720
     gtactgaccc ggcttgattt attacagggt tttgccgccc tgttccagtc cctgaacaga       780
     caggatcgcg atgcgattct gggcgtcacg ttcacccgcc gtgcccatga aaatgatgac       840
     tggcgaacag agttgaatgc tttctggcag acatgggtgg atcgaatgaa tctggcgttg       900
     ccggatctga tggtcaccca gactcacacc cgcgcgtctt tattcagttt ttcccgccag       960
     atgcagggaa gccgtgaacc gctggtgtca ctgcttgagg gtctgcttga cggtgaaaat      1020
     atgaacgtga tgctgcgtgg tgtctatctc acctcttcgc ttcagcgcgg gcagatggat      1080
     gatatattca cccagtctgc cgcccgccag taccgactgg gcaataaccc actggcgtcc      1140
     tggcctctgg tggacaccgc gccttatttc acccgcagct tgttcccgca ggcattactc      1200
     gcagagccta atctggcaac ggagagccgc gcctggctga tgcgttcccg tcgccgcctg      1260
     acggttttct ctgccaccgg cggcgtggcg gcactgctgc tcatcaccgg ctggcatcac      1320
     tattacaacg gtaactatca gtccggcatc accgtgctta agcaggccaa agcctttatg      1380
     gatgtgccgc ctccacaggg ggaagatgac tacggcaacc tgcaactgcc gctgctgaac      1440
     ccggtacgcg atgccacact ggcctatggc gactggggcg accgcagccg tctggccgat      1500
     atgggactgt accagggacg acgtatcgga ccttatgtgg aacagaccta tctgcaactg      1560
     ctggagcaac gttacctgcc ctcgctgttt aacgggctgg ttaaagcgat gaatgccgcg      1620
     ccgccggaga gtgaagaaaa actcgcggtg ctgcgcgtga tgcgaatgct ggaggacaaa      1680
     agcggacgta acaatgaggt ggtgaagcag tatatggcaa aacgctggag cgaaaagttc      1740
     cacggccagc gcgatatcca ggcacaactg atgtcccatc ttgactacgc gctggctcat      1800
     actgactggc acgcagagcg tcaggcgggc gacggtgacg ccatcagccg ctggacgcca      1860
     tatgacaagc ccgtggtatc agcacagaaa gaactgagca aactgcctgt ctaccagcgg      1920
     gtttaccaga gcctgaaaac gcgggcgctg ggcgttcttc ctgccgacct caatctgcgt      1980
     gaccaggtag ggccaacctt tgaccaggtg tttacatctg ccgatgacaa caaactggtt      2040
     gttccacagt ttcttacccg ttacggcctg caaagctatt ttgtaaaaca gcgcgatgaa      2100
     ctggttgaac tgacggcgat ggattcctgg gtacttaacc ttacccgcag cgtgaaatac      2160
     agtgacgccg accgcgcgga aatccagcgc cagctcaccg agcagtatat cagcgactac      2220
     accgccacct ggcgggccgg gatggacaat ctgaatatcc gcaattttga gtccatcgga      2280
     caactgaccg gggcgctgga gcaggttatc agcggcgacc agcctttgca gcgggcgctg      2340
     accgtgctgc gtgacaacac acagccaggc gtcttttctg aaaaactctc tgccaaagaa      2400
     cgggatgagg ccctggcaga gccggactac cagttactca cccgtctcgg gcatgagttc      2460
     gccccggaaa acattaccct ggcagtacag aaagacaaag aaagcacgat gcaggccgtg      2520
     tatcagcaac tcaccgagtt gcaccgctac ctgctggcaa tccagaacgc gcctgtacca      2580
     gggaaatcgg cgctgaaagc cgtgcagtta cggcttgatc agaacagcag cgatccgata      2640
     ttcgccaccc gccagatggc aaaaacgctg cctgctccgc tcaaccgctg ggttggcaga      2700
     ctgactgacc aggcctggca tgtggtgatg gtggaggctg tacattatat ggaagtggac      2760
     tggcgcgaca gcgtggtgaa accgtttaac gagcaactgg caaataacta tccgtttaat      2820
     ccgcgttctg cacaggatgc ctcactggat gccttcgaac gcttctttaa accggatggc      2880
     atactggata ccttctacca gcagaacctg aagctgttta tcgataatga cctgagtctg      2940
     gaggatggcg ataacaacgt cattattcgc gaagatatta ttgcgcaact ggaaactgcg      3000
     cagaaaatcc gtgacatctt cttcagcaaa cagaacggtc tgggaacatc ctttgccgtg      3060
     gaaacggtat cgctttcagg caataaacgc cgcagtgtac tgaaccttga cggtcagtta      3120
     gtcgattaca gccagggccg taactatacc gcccatctgg tctggcctaa caacatgcgc      3180
     gaaggcaacg aaagtaagct gacgctcatc ggcaccagcg gcaacgcgcc gcgcagtatc      3240
     agcttcagcg ggccgtgggc gcagttccgc ctgttcgggg ccggacaact gaccggagta      3300
     caggatggca actttaccgt gcgctttagc gtggacggtg gcgcgatgac ctaccgtgtg      3360
     cataccgaca cggaagataa cccgttcagc ggtgggttgt tcagccagtt tggtctgtca      3420
     gacacactgt actga                                                       3435
//

If you have problems or comments...

PBIL Back to PBIL home page