(data stored in ACNUC7421 zone)

EMBL: BA000007.KEFC

BA000007.KEFC        Location/Qualifiers
FT   CDS_pept        52184..54046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefC"
FT                   /locus_tag="ECs_0050"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33473"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33473"
FT                   /db_xref="GOA:Q8XA20"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR023941"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA20"
FT                   /protein_id="BAB33473.1"
FT                   /translation="MDSHTLVQALIYLGSAALIVPIAVRLGLGSVLGYLIAGCIIGPWG
FT                   LRLVTDAESILHFAEIGVVLMLFIIGLELDPQRLWKLRAAVFGGGALQMVICGGLLGLF
FT                   CMLLGLRWQVAELIGMTLALSSTAIAMQAMNERNLMVTQMGRSAFAVLLFQDIAAIPLV
FT                   AMIPLLAASSASTTMGAFALSALKVAGALVLVVLLGRYVTRPALRFVARSGLREVFSAV
FT                   ALFLVFGFGLLLEEVGLSMAMGAFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIGVG
FT                   MSIDFGTLIENPLRIVILLLGFLIIKIAMLWLIARPLQVPNKQRRWFAVLLGQGSEFAF
FT                   VVFGAAQMANVLEPEWAKSLTLAVALSMAATPILLVILNRLEQSSTEEAREADEIDEEQ
FT                   PRVIIAGFGRFGQITGRLLLSSGVKMVVLDHDPDHIETLRKFGMKVFYGDATRMDLLES
FT                   AGAAKAEVLINAIDDPQTNLQLTEMVKEHFPHLQIIARARDVDHYICLRQAGVEKPERE
FT                   TFEGALKTGRLALESLGLGPYEARERADVFRRFNIQMVEEMAMVENDTKARAAVYKRTS
FT                   AMLSEIITEDREHLSLIQRHGWQGTEEGKHTGNMADEPETKPSS"
     atggatagcc atacgctggt tcaggcgctg atttatctcg gttcggcggc gctgattgta        60
     cccattgcag tacgtcttgg tctgggatcg gtacttggct acctgatcgc cggctgcatt       120
     attggcccgt gggggctgcg actggtgacc gatgccgaat ctattctgca ctttgccgag       180
     attggcgtgg tgctgatgct gtttattatc ggcctcgaac tcgatccaca aaggctgtgg       240
     aagctgcgtg cggcagtgtt tggcggtggc gcattgcaga tggtgatttg cggcggcctg       300
     ctggggctgt tctgtatgtt acttgggctg cgctggcagg tcgcggaatt gatcggcatg       360
     acgctggcgc tctcctctac ggcgattgcc atgcaggcga tgaatgaacg caatctgatg       420
     gtgacgcaaa tgggccgcag tgcctttgcg gtgctgctgt tccaggatat cgcggcaatc       480
     ccgctggtgg cgatgatccc gctactggcg gcgagcagtg cctcgacgac gatgggcgca       540
     tttgctctct cggcgttaaa agtggcgggc gcgctggtgc tggtggtact gctggggcgc       600
     tatgtcacgc gtccggcgct gcgttttgtt gcccgctctg gcttgcggga agtgtttagt       660
     gccgtggcgt tattccttgt gtttggcttt ggtttgctgc tggaagaggt cggcttgtcg       720
     atggcgatgg gcgcgtttct ggcgggcgta ctgctggcaa gctcggaata ccgtcatgcg       780
     ctggaaagcg atatcgaacc ctttaaaggt ttgctgttgg ggctgttttt catcggtgtt       840
     ggcatgtcga tagactttgg cacgctgatt gaaaacccat tgcgcattgt cattttgctg       900
     ctcggtttcc tcatcatcaa aatcgccatg ctgtggctga ttgcccgacc gttgcaggtg       960
     ccaaataaac agcgtcgctg gtttgcggtg ttgttagggc agggcagtga gtttgccttt      1020
     gtggtatttg gcgcggcgca gatggcgaat gtgctggagc cggagtgggc gaaatcgctg      1080
     accctggcgg tggcgctgtc gatggcggca acgccgattc tgctggtgat cctcaatcgc      1140
     cttgagcaat cttctactga agaggcgcgt gaagccgatg agatcgacga agaacagccg      1200
     cgggtaatca ttgccggatt cggtcgtttc gggcagatca ccggacgttt actgctctcc      1260
     agcggggtga aaatggtggt gctcgatcac gatccggacc atatcgaaac gctgcgtaaa      1320
     tttggtatga aagtgtttta tggcgatgcc acgcggatgg atttactgga atctgcggga      1380
     gcggcgaaag cggaagtgct gattaacgcc attgacgatc cgcaaaccaa cctgcaactg      1440
     acggagatgg tgaaagaaca tttcccgcat ttgcagatta ttgcccgcgc ccgcgatgtc      1500
     gatcactaca tttgtttgcg tcaggcaggc gtcgaaaagc cagagcgtga aacctttgaa      1560
     ggtgcgctga aaaccgggcg tctggcgctg gaaagtttag gtctggggcc gtatgaagcg      1620
     cgagaacgtg ccgatgtgtt ccgccgcttt aatattcaga tggtggaaga gatggcaatg      1680
     gttgagaatg acaccaaagc ccgcgcggcg gtctataaac gcaccagcgc gatgttaagt      1740
     gagatcatca ccgaggaccg cgaacatctg tcattaattc aacgacatgg ctggcaggga      1800
     acagaagaag gtaaacatac cggcaacatg gcggatgaac cggaaacgaa accctcatcc      1860
     taa                                                                    1863
//

If you have problems or comments...

PBIL Back to PBIL home page