(data stored in ACNUC7421 zone)

EMBL: BA000007.LAPB

BA000007.LAPB        Location/Qualifiers
FT   CDS_pept        601826..603988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lapB"
FT                   /locus_tag="ECs_0543"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33966"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33966"
FT                   /db_xref="GOA:Q8XD16"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017750"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XD16"
FT                   /protein_id="BAB33966.2"
FT                   /translation="MKKNAQSVEAWLEAMIAVARYYRLDFSQENVRATVNWERDSKREE
FT                   LLTDMARQLGMGLRLVEFSADSLNPWRLPLIAVFDNQQIGVITRRDNHDNISVQFSGDE
FT                   GLETTLNVADIEDKIVELALLRPLSAIPDARVDDYIRPYQANWFWSLSLKDWRRYGDIM
FT                   LASLVANVLALAAMIFSMQVYDRVVPAQSYPTLWVLFAGVMMAILFEFCMRMVRTHLSD
FT                   VIGKRADLRISDRVFGHALRLKNNVRSKSTGSFISQIRELESVRELITSTTIGAVADLP
FT                   FFLLFVFILWMIGGWLVLVVLLALPLLVIPGLLVQRPLARLANEGMRESAVRNATLVEA
FT                   VQSIEDIKLLRAEQRFQNQWNHTNDVASSISMKQRFLTGLLLTWTQEVQSIVYVVVLLV
FT                   GCFMVMNGDMTTGALVGTTILASRTIAPLSQISGVLSRWQQAKVARNGLDELMKRPVDQ
FT                   PEHGKLVHKAVLHGNYQFSNAVFYYDEEEKIADVAIGKLNIQAGEKIAILGRNGAGKST
FT                   LLQMLAGMRIAQQGQVLLDNISIGQLDPADLRRDMGLLSQTGRLFFGSLRENLTMGMPE
FT                   ASDEDIERALTLSGALPFVQKQKNGLNYMIQEGGFGLSGGQRQTLLLARLLISQPNIVL
FT                   LDEPSASLDEMAEAYLIEQLKQWIGHRTLIIATHRTAMLQLVDRIIVMDQGRIVMDGAK
FT                   EAILREQGEPTARRVVLQEKNKGSAA"
     atgaaaaaaa atgcccagtc cgtggaagcc tggctggagg cgatgatcgc cgtggcgcgc        60
     tattatcggc tcgatttttc tcaggagaat gtgcgcgcga ccgtcaactg ggagcgcgac       120
     agtaagcggg aggagttact caccgacatg gcgcggcagt tagggatggg gttgcggttg       180
     gtggagtttt ccgccgattc gcttaacccc tggcgtctgc cgctgatcgc ggtgtttgat       240
     aatcagcaga ttggcgtgat cacccgtcgc gacaatcatg acaatatcag cgttcagttc       300
     agcggtgacg aagggctgga aactacactt aacgtcgcgg atattgaaga taaaatcgtc       360
     gaactggcgc tgctgcgccc tctcagcgcc atccctgacg cgcgggtgga tgactatatt       420
     cgcccgtatc aggcgaactg gttctggagt ctttcgctaa aagactggcg gcgctacggc       480
     gatattatgc tggcgtcact ggtggcgaac gtgctggcgc tggcggcgat gattttctcg       540
     atgcaggttt acgatcgggt ggttccggcg caatcgtacc cgacgctatg ggtgcttttc       600
     gccggggtga tgatggcgat cctgtttgag ttctgtatgc gcatggtgcg tacgcatcta       660
     tctgatgtga tcggaaagcg ggcagacctg cgtatttcgg atcgcgtttt tggtcatgcg       720
     ctacggctga aaaacaacgt gcgatcgaaa tccaccggat cgtttatctc gcagatccgc       780
     gaactggaat cagtgcggga gcttattacg tccaccacca tcggcgcggt ggcggacctg       840
     ccattcttcc tgctgtttgt ctttattttg tggatgatcg gcggctggct ggtgctggtg       900
     gttttgctgg cgctgccgtt gctggtgatc cccggcctgc tggtgcaacg cccgctggcg       960
     cggctggcga acgaaggaat gcgcgagtca gcggtacgca acgctacgct ggtggaagcc      1020
     gtgcagtcga ttgaagatat taaactgctg cgcgccgaac agcgttttca gaatcagtgg      1080
     aaccacacca acgacgtggc ctcgtccatc agcatgaagc aacgttttct caccgggctg      1140
     ctgctcacct ggacccagga agtgcagtcc atcgtctacg tggtggtgct gctggtgggc      1200
     tgctttatgg tgatgaacgg cgacatgacc accggcgcgc tggtcgggac gacgatcctg      1260
     gcttcgcgca ccattgcgcc gctgtcgcag atatccggcg tgctctcgcg ctggcagcag      1320
     gcgaaagtag cacgtaacgg ccttgatgaa ctgatgaagc gcccggtgga tcagccggaa      1380
     cacggcaaac tggtgcataa agcggtgctg cacggtaatt atcagttcag caacgcggtg      1440
     ttttattacg acgaagaaga gaagattgcc gatgtagcga ttggcaaact caacattcag      1500
     gctggtgaga aaatcgccat tctcgggcgc aacggcgcgg gtaaatcgac gctactgcaa      1560
     atgctcgccg gaatgcgtat cgcccagcag gggcaggtgt tgctggataa catcagtatc      1620
     gggcagcttg atccggcaga tctgcggcga gacatggggc tactcagcca gaccgggcga      1680
     ctgttctttg gttcgctgcg ggaaaacctc accatgggga tgccggaagc cagcgatgaa      1740
     gatatcgaac gcgcgttaac cctcagcgga gcgctgccct ttgtgcagaa gcagaaaaac      1800
     ggcctcaact acatgattca ggaaggggga tttggcctct ctggtggtca gcggcaaacg      1860
     ctgctgctgg cgcggctact catctctcag ccgaatatcg tcctgctcga cgaacccagc      1920
     gcctcactgg acgaaatggc agaagcgtat ttaatcgaac aactgaaaca gtggattggg      1980
     catcgcacgc tgattatcgc cactcaccgc acggcgatgc tgcaactggt ggataggata      2040
     atcgtgatgg atcaggggcg gattgtgatg gacggcgcga aagaggccat tttgcgtgaa      2100
     cagggcgagc ccacagcgcg acgggtggtg ttgcaggaga agaataaggg gtctgcggca      2160
     tga                                                                    2163
//

If you have problems or comments...

PBIL Back to PBIL home page