(data stored in ACNUC7421 zone)

EMBL: BA000007.LEUC

BA000007.LEUC        Location/Qualifiers
FT   CDS_pept        complement(84072..85472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="ECs_0076"
FT                   /product="3-isopropylmalate dehydratase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33499"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33499"
FT                   /db_xref="GOA:Q8XA00"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA00"
FT                   /protein_id="BAB33499.1"
FT                   /translation="MAKTLYEKLFDAHVVYEAENETPLLYIDRHLVHEVTSPQAFDGLR
FT                   AHGRPVRQPGKTFATMDHNVSTQTKDINACGEMARIQMQELIKNCKEFGVELYDLNHPY
FT                   QGIVHVMGPEQGVTLPGMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLKQGRA
FT                   KTMKIEVQGKAAPGITAKDIVLAIIGKTGSAGGTGHVVEFCGEAIRDLSMEGRMTLCNM
FT                   AIEMGAKAGLVAPDETTFNYVKGRLHAPKGKDFDDAVAYWKTLQTDEGATFDTVVTLQA
FT                   EEISPQVTWGTNPGQVISVNDNIPDPASFADPVERASAEKALAYMGLKPGILLTEVAID
FT                   KVFIGSCTNSRIEDLRAAAEIAKGRKVAPGVQALVVPGSGPVKAQAEAEGLDKIFIEAG
FT                   FEWRLPGCSMCLAMNNDRLNPGERCASTSNRNFEGRQGRGGRTHLVSPAMAAAAAVTGH
FT                   FADIRNIK"
     atggctaaga cgttatacga aaaattattc gacgctcacg tagtgtacga agccgaaaac        60
     gaaaccccgc tgttatatat cgaccgccac ctggtgcatg aagtgacctc accgcaggcg       120
     ttcgatggtc tgcgcgccca cggtcgcccg gtacgtcagc cgggcaaaac cttcgccacc       180
     atggatcaca acgtctctac ccagactaaa gacattaatg cctgcggtga aatggcgcgc       240
     atccagatgc aggagctgat caaaaactgc aaagaatttg gcgtcgaact gtatgacctg       300
     aatcacccct atcaagggat cgtccacgta atggggccgg aacagggcgt gaccttgccg       360
     gggatgacca ttgtctgcgg cgactcgcat accgccaccc acggcgcgtt tggcgcactg       420
     gcctttggta tcggcacttc cgaagttgaa cacgtactgg caacgcaaac cctgaaacag       480
     ggccgtgcga agaccatgaa aattgaagtc cagggcaaag ccgcgccggg cattaccgca       540
     aaagatatcg tgttggcaat tatcggtaaa accggtagcg caggcggcac cgggcatgtg       600
     gtggagtttt gcggcgaagc aatccgtgat ttaagcatgg aaggtcggat gaccctgtgc       660
     aatatggcaa tcgaaatggg cgcgaaagcc ggtctggttg cacctgacga aaccaccttt       720
     aactatgtca aaggccgtct gcatgcgccg aaaggcaaag atttcgacga cgccgttgcc       780
     tactggaaaa ccctgcaaac cgacgaaggc gcaactttcg ataccgttgt cactttgcag       840
     gcagaagaga tttcaccgca ggtcacctgg ggaactaacc caggccaggt gatttccgtg       900
     aacgacaata ttcccgatcc ggcttcgttt gccgatccgg ttgaacgcgc gtcggcagaa       960
     aaagcgttgg cctatatggg gctgaaaccg ggtattctgc tgaccgaagt ggctatcgac      1020
     aaagtgttta tcggttcctg caccaactca cgtattgaag atttacgcgc ggcggcggaa      1080
     atcgccaaag ggcggaaagt cgcgccaggc gtacaggcgc tggtggttcc cggctctggt      1140
     ccggtaaaag cgcaggcgga agcagaaggt ctggataaaa tctttattga agccggtttt      1200
     gaatggcgct tgcctggctg ctcaatgtgt ctggcgatga acaacgaccg tctgaatccg      1260
     ggcgaacgtt gtgcctccac cagcaaccgt aactttgaag gccgtcaggg gcgcggcggg      1320
     cgcacgcatc tggtcagccc ggcaatggct gccgccgcgg ctgtgaccgg ccatttcgcc      1380
     gacattcgca acattaaata a                                                1401
//

If you have problems or comments...

PBIL Back to PBIL home page