(data stored in ACNUC7421 zone)

EMBL: BA000007.LEUD

BA000007.LEUD        Location/Qualifiers
FT   CDS_pept        complement(83456..84061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="ECs_0075"
FT                   /product="3-isopropylmalate dehydratase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33498"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33498"
FT                   /db_xref="GOA:Q8XA01"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XA01"
FT                   /protein_id="BAB33498.1"
FT                   /translation="MAEKFIKHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFN
FT                   DWRFLDEKGQQPNPDFVLNFSQYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAP
FT                   SFADIFYGNSFNNQLLPVKLSDAEVDELFALVKANPGIHFDVDLEAQEVKAGEKTYRFT
FT                   IDAFRRHCMMNGLDSIGLTLQHDDAIAAYEAKQPAFMR"
     atggcagaga aatttatcaa acacacaggc ctggtggttc cgctggatgc cgccaatgtc        60
     gataccgatg caatcatccc gaaacagttt ttgcagaaag tgacccgtac tggttttggc       120
     gcgcatctgt ttaacgactg gcgttttctg gatgaaaaag gccaacagcc aaacccggac       180
     ttcgtgctga acttctcgca gtatcagggc gcttccattt tgctggcacg agaaaacttc       240
     ggctgtggct cctcgcgtga gcacgcgccc tgggcattga ccgactacgg ttttaaggtg       300
     gtgattgcgc cgagttttgc tgacatcttc tacggcaata gctttaacaa ccagctgctg       360
     ccggtgaaat taagcgacgc agaagtggat gagctgtttg cgctggtgaa agccaatccg       420
     gggattcatt ttgatgtaga cctggaagcg caagaggtga aagcgggtga gaaaacctat       480
     cgctttacca ttgatgcctt ccgccgccac tgcatgatga acggtctgga cagcattggg       540
     cttaccttgc agcacgacga cgccattgcg gcttatgaag cgaagcaacc cgcgtttatg       600
     cgttag                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page