(data stored in ACNUC7421 zone)

EMBL: BA000007.LIPB

BA000007.LIPB        Location/Qualifiers
FT   CDS_pept        complement(742995..743636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="ECs_0668"
FT                   /product="lipoate-protein ligase B"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34091"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34091"
FT                   /db_xref="GOA:P60721"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60721"
FT                   /protein_id="BAB34091.2"
FT                   /translation="MYQDKILVRQLGLQPYEPISQAMHEFTDTRDDSTLDEIWLVEHYP
FT                   VFTQGQAGKAEHILMPGDIPVIQSDRGGQVTYHGPGQQVMYVLLNLKRRKLGVRELVTL
FT                   LEQTVVNTLAELGIEAHPRADAPGVYVGEKKICSLGLRIRRGCSFHGLALNVNMDLSPF
FT                   LRINPCGYAGMEMAKISQWKPEATTNNIAPRLLENILALLNNPDFEYITA"
     ttgtatcagg ataaaattct tgtccgccag ctcggtcttc agccttacga gccaatctcc        60
     caggctatgc atgaattcac cgatacccgc gatgatagta cccttgatga aatctggctg       120
     gtcgagcact atccggtatt cacccaaggg caggcaggaa aggcggagca cattttaatg       180
     cccggtgata ttccggtgat tcagagcgat cgcggtgggc aggtgactta tcacgggccg       240
     gggcaacagg tgatgtatgt attgcttaac ctgaaacgcc gtaaactcgg tgtgcgtgaa       300
     ctggtgacct tgcttgagca aacagtggtg aataccctgg ctgaactggg tatagaagcg       360
     catcctcggg ctgacgcgcc aggtgtctat gttggggaaa agaaaatttg ctcactgggt       420
     ttacgtattc gacgcggttg ttcattccac ggtctggcat taaacgtcaa tatggatctt       480
     tcaccatttt tacgtattaa tccttgtggg tatgccggaa tggaaatggc taaaatatca       540
     caatggaaac ccgaagcgac gactaataat attgcaccac gtttactgga aaatatttta       600
     gcgctactaa acaatcctga cttcgaatat attaccgctt aa                          642
//

If you have problems or comments...

PBIL Back to PBIL home page