(data stored in ACNUC7421 zone)

EMBL: BA000007.MBHA

BA000007.MBHA        Location/Qualifiers
FT   CDS_pept        288079..288714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mbhA"
FT                   /locus_tag="ECs_0257"
FT                   /product="flagellar system protein MbhA"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33679"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33679"
FT                   /db_xref="GOA:Q8X7Q3"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7Q3"
FT                   /protein_id="BAB33679.2"
FT                   /translation="MAVPEETEKKARDVNEKTALLKKKSATELGELATSINTIARDAHM
FT                   EANLEMEIVPQGLRVLIKDDQNRNMFERGSAQIMPFFKTLLVELAPVFDSLDNKIIITG
FT                   HTDAMAYKNNIYNNWNLSGDRALSARRVLEEAGMPEDKVMQVSAMADQMLLDAKNPQSA
FT                   GNRRIEIMVLTKSASDTLYQYFGQHGDKVVQPLVQKLDKQQVLSQRTR"
     gtggcggtgc cggaagagac ggagaaaaaa gcgcgtgatg tgaatgagaa aacggcgctg        60
     ctgaagaaga aatccgccac cgagcttggc gagctggcaa ccagtatcaa caccattgcc       120
     cgtgatgcgc atatggaagc gaatctggag atggagattg tcccgcaggg attacgcgtg       180
     ctgattaaag acgaccagaa tcgcaatatg ttcgaacgcg gcagcgcgca gattatgccg       240
     ttctttaaaa ctttgctggt ggagctcgcg ccagtgttcg actcgctcga taacaaaatt       300
     attattaccg ggcataccga tgcgatggcc tacaaaaaca atatctacaa caactggaac       360
     ctttcgggcg atcgcgcgct ttcagctcgt cgggtgctgg aagaggccgg aatgccggaa       420
     gataaagtga tgcaggtaag cgcaatggcg gaccagatgc tgctggacgc gaaaaatccg       480
     caaagcgcgg gcaaccgacg cattgagatt atggtgctga ccaaaagtgc gtccgatacg       540
     ctgtatcaat actttggtca gcatggggat aaagtggtgc agccgctggt gcaaaagctg       600
     gataagcagc aggtgctttc gcagcgaacg cgctaa                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page