(data stored in ACNUC7421 zone)

EMBL: BA000007.MRCB

BA000007.MRCB        Location/Qualifiers
FT   CDS_pept        169053..171587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcB"
FT                   /locus_tag="ECs_0153"
FT                   /product="penicillin-binding protein 1B"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33576"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33576"
FT                   /db_xref="GOA:Q8X903"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR011813"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR028166"
FT                   /db_xref="InterPro:IPR032730"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X903"
FT                   /protein_id="BAB33576.1"
FT                   /translation="MAGNDREPIGRKGKPTRPVKQKVSRRRYEDDDDYDDYDDYEDEEP
FT                   MPRKGKGKGKGRKPRGKRGWLWLLLKLAIVFAVLIAIYGVYLDQKIRSRIDGKVWQLPA
FT                   AVYGRMVNLEPDMTISKNEMVKLLEATQYRQVSKMTRPGEFTVQANSIEMIRRPFDFPD
FT                   SKEGQVRARLTFDGDHLATIVNMENNRQFGFFRLDPRLITMISSPNGEQRLFVPRSGFP
FT                   DLLVDTLLATEDRHFYEHDGISLYSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSSE
FT                   RSYWRKANEAYMALIMDARYSKDRILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPVE
FT                   ELSLDQQALLVGMVKGASIYNPWRNPKLALERRNLVLRLLQQQQIIDQELYDMLSARPL
FT                   GVQPRGGVISPQPAFMQLVRQELQAKLGDKVKDLSGVKIFTTFDSVAQDAAEKAAVEGI
FT                   PALKKQRKLSDLETAIVVVDRFSGEVRAMVGGSEPQFAGYNRAMQARRSIGSLAKPATY
FT                   LTALSQPKIYRLNTWIADAPIALRQPNGQVWSPQNDDRRYSESGRVMLVDALTRSMNVP
FT                   TVNLGMALGLPAVTDTWIKLGVPKDQLHPVPAMLLGALNLTPIEVAQAFQTIASGGNRA
FT                   PLSALRSVIAEDGKVLYQSFPQAERAVPAQAAYLTLWTMQQVVQRGTGRQLGAKYPNLH
FT                   LAGKTGTTNNNVDTWFAGIDGSTVTITWVGRDNNQPTKLYGASGAMSIYQRYLANQTPT
FT                   PLNLVPPEDIADMGVDYDGNFVCSGGMRVLPVWTSDPQSLCQQSEMQQQPSGNPFDQSS
FT                   QPQQQPQQQPAQQEQKDSDGVAGWIKDMFGSN"
     atggccggga atgaccgcga gccaattgga cgcaaaggga aaccgacgcg tccggtcaaa        60
     caaaaggtaa gccgtcgtcg ttacgaagat gacgatgatt acgacgatta tgatgactat       120
     gaggatgaag aaccgatgcc gcgcaaaggt aagggcaaag gcaaagggcg taagcctcgt       180
     ggcaaacgcg gctggctatg gctgctgtta aaactggcta tcgtttttgc cgtgctgatc       240
     gccatttacg gcgtttatct cgatcaaaaa attcgtagcc gtattgatgg caaggtctgg       300
     caactgcctg cggcagttta tggtcgaatg gtcaaccttg agccagacat gaccatcagc       360
     aagaacgaga tggtgaagct gctggaggca acacagtatc gtcaggtgtc gaaaatgacc       420
     cgtcctggcg aatttaccgt gcaggccaac agcattgaga tgattcgccg tccgtttgat       480
     ttcccggaca gtaaagaagg gcaggtgcgc gcgcgtctga cctttgatgg cgatcatctg       540
     gcgaccatcg tcaatatgga gaacaaccgt cagttcggtt tcttccgtct tgatccgcgt       600
     ctgatcacca tgatctcctc accaaacggt gagcagcgtt tgtttgtgcc gcgcagtggt       660
     ttcccggatt tgctggtgga tactttgctg gcgacagaag accgccattt ctacgagcat       720
     gatggaatca gtctctactc catcggacgt gcggtgctgg caaacctgac cgcaggtcgc       780
     acggtgcagg gggcgagtac gctgacgcaa cagctggtga aaaacctgtt cctctccagc       840
     gagcgctctt attggcgtaa agcgaatgaa gcctacatgg cgctgatcat ggacgcgcgt       900
     tacagcaaag accgtattct tgagctgtat atgaacgagg tgtatctcgg tcagagcggc       960
     gacaacgaaa tccgcggctt cccgctggcg agcttgtatt actttggtcg cccggtagaa      1020
     gaattgagcc tcgatcagca ggcgctgtta gtcggtatgg tgaaaggagc gtccatctac      1080
     aacccgtggc gtaacccgaa actggcgctg gagcgacgta atctggtact gcgtctgctg      1140
     caacagcaac agattattga tcaagaactc tatgacatgt tgagtgcgcg tccgctgggg      1200
     gttcagccgc gcggtggggt gatctctcct cagccagcct ttatgcaact ggtgcgtcag      1260
     gagcttcagg ctaaattagg cgataaggta aaagatctct ccggcgtgaa gatcttcact      1320
     acctttgact cggtggccca ggacgcggca gaaaaagccg ccgtggaagg tattccggca      1380
     ctgaagaaac agcgtaagtt gagcgatctt gaaactgcga ttgtggtcgt cgaccgcttt      1440
     agtggtgaag ttcgtgcgat ggtcggaggt tctgagccgc agtttgcggg ctacaaccgt      1500
     gcgatgcagg cgcgtcgttc gattggttcc cttgcaaaac cagcgactta tctgacggcc      1560
     ttaagccagc cgaaaatcta tcgtctgaat acgtggattg cggatgcgcc aattgcgctg      1620
     cgtcagccga atggccaggt ctggtcaccg cagaatgatg accgtcgtta tagcgaaagc      1680
     ggcagagtga tgctggtgga tgcgttgacc cgttcgatga acgtgccgac ggtaaatctg      1740
     gggatggcgc tggggctgcc tgcggttacg gatacctgga ttaaactggg cgtaccgaaa      1800
     gatcagttgc atccggttcc ggcaatgctg ctgggggcgt tgaacttaac gccaatcgaa      1860
     gtggcgcagg cattccagac catcgccagc ggtggtaacc gtgcaccgct ttctgcgctg      1920
     cgttcggtaa tcgcggaaga tggcaaagtg ctgtatcaga gcttcccgca ggcggaacgc      1980
     gctgttccgg cgcaggcggc gtatctgaca ctatggacca tgcagcaggt ggtacaacgc      2040
     ggtacgggtc gtcagcttgg ggcgaaatac ccgaacctgc atctggcagg gaaaacaggg      2100
     actaccaaca ataacgtaga tacctggttt gcgggcattg acggcagcac ggtgaccatc      2160
     acctgggtcg gccgtgataa caaccagccg accaaactgt atggagccag cggggcaatg      2220
     tcgatttatc agcgttatct ggctaaccag acgccaacgc cgctgaatct tgttccgcca      2280
     gaagatattg cagatatggg cgtggactac gacggcaact ttgtttgcag cggtggcatg      2340
     cgtgtcttgc cggtctggac cagcgatccg caatcgctgt gccagcagag tgagatgcag      2400
     cagcagccgt caggcaatcc gtttgatcag tcttctcagc cgcagcaaca gccgcaacag      2460
     caacctgctc agcaagagca gaaagacagc gacggtgtag ccggttggat taaggatatg      2520
     tttggtagta attaa                                                       2535
//

If you have problems or comments...

PBIL Back to PBIL home page