(data stored in ACNUC7421 zone)

EMBL: BA000007.NUSB

BA000007.NUSB        Location/Qualifiers
FT   CDS_pept        499393..499812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="ECs_0469"
FT                   /product="transcription antitermination protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33892"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33892"
FT                   /db_xref="GOA:P0A782"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A782"
FT                   /protein_id="BAB33892.1"
FT                   /translation="MKPAARRRARECAVQALYSWQLSQNDIADVEYQFLAEQDVKDVDV
FT                   LYFRELLAGVATNTAYLDGLMKPYLSRLLEELGQVEKAVLRIALYELSKRSDVPYKVAI
FT                   NEAIELAKSFGAEDSHKFVNGVLDKAAPVIRPNKK"
     gtgaaacctg ctgctcgtcg ccgcgctcgt gagtgtgccg tccaggcgct ctactcctgg        60
     cagttgtccc agaacgacat cgctgatgtt gaataccagt tcctggctga acaggatgta       120
     aaagacgttg acgtcctgta cttccgtgag ctgctggccg gggtggcgac taataccgca       180
     tacctcgacg gactgatgaa gccatacctg tcccgcctgc tggaagaact gggacaggta       240
     gaaaaagcag tactgcgcat tgcgctgtac gaactgtcta aacgtagcga tgtgccatac       300
     aaagtggcca ttaacgaagc gatcgaactg gcgaaatcgt tcggcgcaga agacagccat       360
     aagttcgtca acggcgtact cgataaagca gcacctgtga ttcgccctaa caaaaagtaa       420
//

If you have problems or comments...

PBIL Back to PBIL home page