(data stored in ACNUC7421 zone)

EMBL: BA000007.PAOB

BA000007.PAOB        Location/Qualifiers
FT   CDS_pept        complement(333340..334296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paoB"
FT                   /locus_tag="ECs_0315"
FT                   /product="FAD-containing subunit of PaoABC aldehyde
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33738"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33738"
FT                   /db_xref="GOA:Q8X6J0"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X6J0"
FT                   /protein_id="BAB33738.1"
FT                   /translation="MKAFTYERVNTPAEAALSAQRVPGAKFIAGGTNLLDLMKLEIETP
FT                   THLIDVNGLGLDKIEVTDAGGLRIGALVRNTDLVAHERVRRDYAVLSRALLAGASGQLR
FT                   NQATTAGNLLQRTRCPYFYDTNQPCNKRLPGSGCAALEGFSRQHAVVGVSEACIATHPS
FT                   DMAVAMRLLDAVVETITPEGKTRSITLADFYHPPGKTPHIETALLPGELIVAVTLPPPL
FT                   GGKHIYRKVRDRASYTFALVSVAAIIQPDGSGRVALGGVAHKPWRIEAADAQLSQGAQA
FT                   VYDALFASAHPTAENTFKLLLAKRTLASVLAEARAQA"
     atgaaggcgt ttacctatga acgagtgaac acccccgccg aggcggcact tagcgctcag        60
     cgcgtacccg gcgcaaaatt tatcgcgggc gggaccaatc tgctggacct gatgaagctg       120
     gaaattgaaa cgcccaccca ccttatcgat gtgaacgggc tcgggctcga taagatcgaa       180
     gtgaccgacg cgggtgggct gcgcatcggc gcactggtac ggaacaccga cctggtggct       240
     cacgagcgcg tgcgtcgtga ttacgcggta ctctcccgcg ccctgctcgc tggcgcgtct       300
     ggtcagttac gcaatcaggc aaccacagca ggtaatctgc tccagcgcac gcgctgcccc       360
     tatttttacg acaccaatca gccctgcaat aagcgcctgc ccgggagcgg ctgcgcggcg       420
     cttgaaggct ttagccgtca gcacgcggtg gtaggcgtaa gcgaagcctg cattgccacc       480
     catccgagcg atatggcggt cgcaatgcgg ttgctggatg cggtggtgga aaccatcacg       540
     ccggagggaa agactcgcag tatcacactg gctgattttt atcacccacc ggggaaaacg       600
     ccgcacattg aaaccgccct gcttcccggt gagcttatcg ttgcggtgac gttacctccg       660
     ccgctcggcg gaaaacatat ctaccgtaag gtgcgcgatc gcgcctccta cacctttgcc       720
     ctggtatcgg tcgcggcgat tattcagcct gacggcagcg ggcgcgtcgc gctgggcgga       780
     gtagcacata agccctggcg cattgaggct gcggatgctc agctatccca gggggcgcag       840
     gccgtatatg acgcgctgtt cgccagcgcc catcccaccg ctgaaaacac ctttaaactc       900
     ctgttggcga agcgaacgct tgcctccgta ctggctgaag cgagggcaca agcatga          957
//

If you have problems or comments...

PBIL Back to PBIL home page