(data stored in ACNUC7421 zone)

EMBL: BA000007.PAOC

BA000007.PAOC        Location/Qualifiers
FT   CDS_pept        complement(331145..333343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paoC"
FT                   /locus_tag="ECs_0314"
FT                   /product="moco-containing subunit of PaoABC aldehyde
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33737"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33737"
FT                   /db_xref="GOA:Q8X6J4"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X6J4"
FT                   /protein_id="BAB33737.1"
FT                   /translation="MKFDKPAGENPIDQLKVVGRPHDRIDGPLKTTGTARYAYEWHEES
FT                   PNAAYGYIVGSAIAKGRLTALDTDAAQKAPGVLPVITASNAGALSKGDKNTARLLGGPT
FT                   IEHYHQAIALVVAETFEQARAAASLVQAHYRRNKGAYSLADEKQAVSQPPEDTPDKNVG
FT                   DFDGAFSSAAVKIDATYTTPDQSHMAMEPHASMAVWDGNKLTLWTSNQMIDWCRTDLAK
FT                   TLKVPVENVRIISPYIGGGFGGKLFLRSDALLAALAARAVKRPVKVMLPRPSIPNNTTH
FT                   RPATLQHLRIGADQSGKITAISHESWSGNLPGGTPETAVQQSELLYAGANRHTGLRLAT
FT                   LDLPEGNAMRAPGEAPGLMALEIAIDELAEKAGIDPVEFRILNDTQIDPADPTRRFSRR
FT                   QLIECLRTGADKFGWKQRNATPGQVRDGEWLVGHGVAAGFRNNLLEKSGARVHLEPNGT
FT                   VTVETDMTDIGTGSYTILAQTAAEMLGVPLEQVAVHLGDSSFPVSAGSGGQWGANTSTS
FT                   GVYAACVKLREMIASAVGFDPEQSQFADGKITNGTRSAILHEATAGGRLTAEESIEFGT
FT                   LSKEYQQSTFAGHFVEVGVHSATGEVRVRRMLAVCAAGRILNPKTARSQVIGAMTMGMG
FT                   AALMEELAVDDRLGYFVNHDMAGYEVPVHADIPKQEVIFLDDTDPISSPMKAKGVGELG
FT                   LCGVSAAIANAVYNATGIRVRDYPITLDKLLDKLPDVV"
     atgaaatttg ataaacccgc aggggaaaac ccgatcgatc agctgaaggt tgtcggtcgt        60
     ccccatgacc gcatcgacgg accgctgaaa actaccggca cggcacgcta cgcctacgaa       120
     tggcatgaag aatcccccaa cgccgcctat ggctatatcg tcggttccgc cattgccaaa       180
     ggacgcctca ccgcccttga tacggacgcc gcgcaaaaag cgccgggcgt actgcctgtc       240
     attaccgcca gtaacgccgg ggcactcagt aaaggcgaca aaaacaccgc caggctgtta       300
     ggcggcccca ctattgagca ctatcatcag gccattgctc tggtagtggc cgagaccttc       360
     gaacaggcgc gagcggcggc ctcgctggtg caggcgcact atcgccgtaa taaaggagct       420
     tactccctgg cggacgaaaa acaggccgtc agtcagccgc cggaagacac gcccgacaag       480
     aacgtcggtg actttgacgg ggctttctcc tccgctgcgg tgaagattga tgctacctac       540
     acgaccccgg accagagcca tatggcgatg gagccgcatg cctcgatggc cgtctgggat       600
     ggaaataagc ttactctctg gacctcaaat cagatgattg actggtgccg caccgatctg       660
     gcaaaaacgc tgaaagtgcc cgtggagaat gtgcgtatta tctccccgta tatcggcgga       720
     gggtttggcg gcaagctgtt cctgagaagc gatgcgctgc tggcggccct cgccgcccga       780
     gcggtgaaac gtccggttaa agtgatgctc ccccgcccct ctattcccaa taacaccacg       840
     caccgccccg ccacccttca gcacttgcgt atcggtgccg accagagcgg gaaaatcacc       900
     gctatctcac atgaaagctg gtctggaaac ctgcccggcg gcacgccgga aacggcggta       960
     cagcaaagcg aattactcta cgccggggca aaccgtcata ccggcctgcg gctcgccacg      1020
     cttgatttgc cggaagggaa cgccatgcgt gcgcccggcg aagcccccgg tctgatggcg      1080
     ctcgaaatcg cgatcgacga actggcggaa aaagcgggca tcgatcccgt cgagtttcgc      1140
     atcctgaatg acactcagat tgaccccgcc gacccgacgc gccgcttctc tcgccgtcag      1200
     cttatcgagt gcttgcgcac cggagcggat aaatttggtt ggaagcagcg caacgccaca      1260
     cccggacagg tgcgcgacgg ggagtggcta gtcggccacg gcgtcgcggc gggctttcgc      1320
     aataatctgc tggaaaaatc gggggctcgg gttcacctcg aaccaaacgg caccgttacc      1380
     gtggaaacgg acatgaccga cattggcacc ggcagctaca ccattctggc ccagacggca      1440
     gcggaaatgc ttggcgtacc gctggagcag gttgcggttc acctcggcga ttccagtttc      1500
     ccggtttctg cgggttctgg tggacaatgg ggcgcgaata cctccacctc cggcgtttac      1560
     gccgcctgtg tgaagcttcg cgaaatgatt gcctcggcag tcgggtttga tcctgagcag      1620
     tcgcagtttg ccgacggcaa gattaccaac ggtacccgaa gcgccatact acatgaggcc      1680
     accgcaggcg gcagactgac agcggaagag agcattgaat tcggaacact gagcaaggag      1740
     taccagcagt cgacctttgc cgggcatttt gtggaggtcg gcgtgcatag cgcgacggga      1800
     gaagttcggg tccggcgtat gctcgctgtg tgtgctgcag gacgcatcct gaatccgaaa      1860
     actgcacgca gccaagtcat tggcgcaatg actatgggca tgggcgcggc actgatggag      1920
     gagctggcgg tggatgaccg tttgggctac ttcgttaatc acgatatggc ggggtatgag      1980
     gtgccggtcc atgcggatat cccaaaacag gaagtgattt tcctggatga taccgacccc      2040
     atatcctccc cgatgaaggc caaaggtgtc ggtgagctgg gcctgtgcgg cgtgagcgcg      2100
     gctatcgcca acgcggtgta taacgccacc ggtattcggg tacgcgatta tcccatcact      2160
     ctggataagc tgctcgataa gctgccggat gtggtttaa                             2199
//

If you have problems or comments...

PBIL Back to PBIL home page