(data stored in ACNUC7421 zone)

EMBL: BA000007.PE19

BA000007.PE19        Location/Qualifiers
FT   CDS_pept        complement(19299..21749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0022"
FT                   /product="fimbrial assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33445"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33445"
FT                   /db_xref="GOA:Q8XA56"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA56"
FT                   /protein_id="BAB33445.1"
FT                   /translation="MLRTTRWVAAIIFLYSFPGYAEETFDTHFMIGGMKGEKVSEYHFD
FT                   NKQPLPGNYELDFYVNNQWRGKQDITIPESPVKPCLPKVLLTKLGVKTGNLNTEDNCIL
FT                   LDKAVHGGQYQWDISEHRLNLTVPQAYINELERGYVPPESWDRGIDAFYTSYNLSQYRS
FT                   YDSNNNSNTASYGRFNSGLNLFSWQLHSDASYSKPDDMKGTWQSNTLYLEHGWSQILST
FT                   VQIGENYTSSLIFDSLRFSGIRLFRDMQMLPDSMQSFTPLVQGVAQSNALITVSQNGYI
FT                   IYQKEVPPGPFTIADLQLSGSGSDLDVSIKEADGSVRSFLVPYSSVPNMLQPGISNFDF
FT                   IAGRSKIYGVKNQEDFLEANYIYGLNNLLTLYGGTILSDNYNAITLGNGWNTPLGAISF
FT                   DATRSSSKLNNDITHEGTSYQVAYNKYLVQTATRFSVAAWRYASQDYRTFSDHLYENDK
FT                   INHQSDYDDFYDIGRKNSLSANIMQPLSNNLGNVSLSALWRNYWGRSGNAKDYQFSYSN
FT                   SWQRISYTFSASQSYDENDKEEERFNLFISIPFYWGDDIAKTRHQINLSNSTSFSKDGY
FT                   SSNNTGITGIAGEHDQLNYGIYVNQQQQNNDTSLGTNLSWRTPIATIDGSYSHSKNAWQ
FT                   SGGSISSGLVVWPGGINITNQLSDTFAILDAPGLEGAHINGQKYNRTNSKGQVVYDLMI
FT                   PHRENHLVLDTANSESETELQGNRQIIAPYRGAVSYVQFTTDQRKPWYIQALRPDGSPL
FT                   TFGYDVLDLQENNIGVVGQGSRLFIRVDEIPTGIKVALNDEQNLFCTITFQHVIDENKT
FT                   YICQ"
     atgttaagga cgacacgatg ggtcgctgct attatttttt tgtattcttt tccgggttat        60
     gctgaagaaa cttttgatac gcactttatg atcggcggca tgaaaggaga aaaagtttcc       120
     gaatatcatt tcgataataa acaaccgctt ccaggaaact acgaacttga tttttatgta       180
     aataaccagt ggcgtggaaa acaagatatc acgatcccag agtcaccagt caaaccatgt       240
     ctgcctaagg tgctactaac caaactgggg gtaaagaccg gtaacctcaa tacagaagat       300
     aattgtattt tactggataa agcggttcat ggtggacaat atcagtggga tatcagtgaa       360
     caccgactaa atttaacagt accacaggcg tatatcaatg aacttgaaag aggttacgtt       420
     cccccggaaa gttgggatcg cggcattgat gctttttata cctcctataa tttaagtcag       480
     tatcgctctt atgacagcaa taataacagt aatacagcca gttatggccg atttaacagt       540
     ggattaaatt tatttagttg gcagttacac tctgatgcca gctatagcaa acccgatgat       600
     atgaaaggca catggcaaag taatactctt tacctggaac atggctggtc gcagatatta       660
     agcacagttc agataggaga aaattacaca tcctcactca tattcgactc tctgagattt       720
     agcggaatac gcttatttcg cgatatgcaa atgctacctg attctatgca gagctttaca       780
     cctttagtac aaggtgttgc gcaaagtaat gccttgataa cggtttcgca aaatggctac       840
     atcatttacc aaaaagaggt tcccccggga ccatttacta tcgcagattt gcaactctcg       900
     ggcagcggct ctgatctcga tgtcagcata aaggaagcag atggcagtgt tcgttccttt       960
     ttggtgccct actcttccgt gcctaacatg ctgcaacctg gtatttcaaa tttcgatttt      1020
     atcgccggac gcagtaagat atatggtgta aagaatcagg aggactttct cgaggcaaat      1080
     tatatatatg gcctcaacaa tcttttgaca ctttatggcg gtacgatttt atccgataac      1140
     tataatgcta taactctggg aaatggttgg aatacaccgc tgggtgccat ctcttttgac      1200
     gctacacgat cgagtagtaa gttaaataat gatataacac acgaaggtac gagctatcag      1260
     gtcgcctata ataaatatct agtacaaacg gccactcgat ttagcgtggc cgcctggcgt      1320
     tatgcttcgc aggattacag gacattcagc gaccatcttt acgaaaatga taaaataaat      1380
     catcagagtg actatgacga tttttatgat attggcagaa aaaatagcct ttctgccaat      1440
     atcatgcaac ctttatccaa taatctggga aatgtatcat taagtgcgct ttggcggaat      1500
     tactgggggc gaagtggaaa tgctaaagat taccaattca gttattccaa tagctggcaa      1560
     cgcatcagtt atactttctc tgccagccaa tcctatgatg aaaacgacaa agaagaggag      1620
     cgttttaatc tgtttatctc cattcctttc tactgggggg atgatattgc caaaacacgt      1680
     caccaaatta acttatcgaa ttcgacctca ttttccaaag atggctattc ctccaacaat      1740
     actggaatta ctggcatagc cggtgaacat gatcagttaa attatggtat atatgttaat      1800
     cagcaacaac aaaataatga tacatcgctt ggtacgaatt taagctggag aactcccatc      1860
     gccacaatag atggcagcta tagccattct aaaaacgcct ggcaaagtgg tggaagtatt      1920
     agtagtggat tagttgtctg gcccggtggt attaatatca ctaaccagct atccgataca      1980
     tttgcaattc tggatgcgcc tgggttagaa ggcgcgcata ttaatggaca aaaatacaac      2040
     cgaacaaaca gcaaaggcca ggttgtttac gacctgatga tacctcatcg tgaaaaccat      2100
     ctggtacttg atacagcaaa cagtgaaagt gaaacagaat tgcagggcaa tcgtcaaatt      2160
     attgcgcctt accgtggagc agtttcttat gtgcagttta caactgacca acgtaagccc      2220
     tggtatatac aggcactgcg tcccgatggt tcgccattaa cttttggcta tgacgtactg      2280
     gatctccagg aaaacaatat tggagtcgtt ggccagggta gtcgcctttt tattcgcgta      2340
     gatgaaattc caactggcat aaaagttgct ctcaatgatg aacagaattt attctgtact      2400
     attacttttc aacacgttat cgatgaaaac aaaacatata tatgccagta a               2451
//

If you have problems or comments...

PBIL Back to PBIL home page