(data stored in ACNUC7421 zone)

EMBL: BA000007.PE209

BA000007.PE209       Location/Qualifiers
FT   CDS_pept        complement(241872..242168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33635"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33635"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7Y3"
FT                   /protein_id="BAB33635.1"
FT                   /translation="MIIINLRLTLLFILATFTYSVQSDEFDDQTTYTQYRYFSTAIPED
FT                   IRRFMFYVDYCFVDLAFDIETDSMTAKNDIINECTPLKERNKTLKEKYKKMKR"
     atgattatta taaatttaag attaacatta ctatttatac tggccacatt tacatattca        60
     gtacaatcag acgaattcga tgatcaaacc acttacacgc aataccgtta tttttccact       120
     gctataccgg aagatatacg tagatttatg ttctacgtag attattgctt tgtagattta       180
     gcattcgata tcgaaactga ctcaatgaca gctaagaatg atattattaa tgaatgtact       240
     ccattaaaag aaagaaacaa gacattaaaa gaaaaatata aaaaaatgaa gagataa          297
//

If you have problems or comments...

PBIL Back to PBIL home page