(data stored in ACNUC7421 zone)

EMBL: BA000007.PE21

BA000007.PE21        Location/Qualifiers
FT   CDS_pept        complement(22495..23028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0024"
FT                   /product="fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33447"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33447"
FT                   /db_xref="GOA:Q8XA52"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA52"
FT                   /protein_id="BAB33447.1"
FT                   /translation="MKKYIIPFVATTLMFSATTFAKDVDQGTLTIRGEVVDTTCYFVNG
FT                   DSTTDIVVEDVVTSAMNQLINNEIYTLKTGSTSHDLEIQCDGNTAPSIEVLASEFDANN
FT                   FTLNKGTAENIGFAIFLDDGTLTRMRPGLKTPLKDNGSGQYFLNLNAQYARTSGNPVTK
FT                   GSVESTVTIKISAD"
     atgaaaaagt atattattcc cttcgttgcg acaacgttga tgtttagcgc aacaaccttc        60
     gccaaggatg tcgatcaagg aacactaacc attagaggag aagttgttga tacaacgtgt       120
     tactttgtta atggtgattc gacaacagat atcgttgtcg aagatgttgt aaccagtgca       180
     atgaatcaac ttatcaataa tgaaatctat actttaaaaa ccggttcaac ctctcatgac       240
     ttagaaattc agtgtgacgg aaatacagcc ccaagtatcg aagtactagc atcagagttt       300
     gatgctaata actttacgct gaataaagga actgctgaga acattggctt tgccattttc       360
     ctcgatgatg ggactttgac cagaatgaga ccagggttaa aaacaccgct gaaagataat       420
     ggctctggtc aatattttct caatttaaat gcacaatatg cccgcacaag tggcaatcct       480
     gttacaaaag gctccgtaga gtcaaccgta acgattaaaa tcagtgcaga ttaa             534
//

If you have problems or comments...

PBIL Back to PBIL home page