(data stored in ACNUC7421 zone)

EMBL: BA000007.PE210

BA000007.PE210       Location/Qualifiers
FT   CDS_pept        complement(242165..242614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33636"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33636"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JDD6"
FT                   /protein_id="BAB33636.1"
FT                   /translation="MRKITIILLLTFSCTKGLAFDISMSKECSGVDELEFIDCVKNSFI
FT                   MSTITLKKAEANIKEKIQKWNSDEDEAIRKEAVISLKRLESSNREFIRYRFAQCSFTLT
FT                   WGARVGRLAFSRLYPCYTELNKIRAMQLNNAYISDFQNPDEISSK"
     atgcgaaaaa taacaattat tctactgctg acattctcat gtacaaaagg tctggcattt        60
     gacatttcca tgtctaaaga atgtagtggt gttgatgaac ttgaatttat tgattgtgtt       120
     aaaaactcat ttattatgag cactattaca cttaaaaaag cagaagcaaa tataaaagag       180
     aaaattcaaa aatggaatag tgatgaggac gaagcaataa gaaaagaagc agttatttct       240
     ttaaaaagac tagagtcttc taatagggaa tttatacgtt acagatttgc tcaatgctct       300
     tttactctaa cctggggggc cagagtaggg cgactggcat tctctcggct atatccatgc       360
     tatactgagt taaacaaaat aagagccatg caactaaaca atgcttacat ttctgacttt       420
     caaaatccag atgagatatc cagcaaatga                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page