(data stored in ACNUC7421 zone)

EMBL: BA000007.PE211

BA000007.PE211       Location/Qualifiers
FT   CDS_pept        complement(242617..243213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33637"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33637"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7X8"
FT                   /protein_id="BAB33637.2"
FT                   /translation="MLWTENDAENTSQWNGYPLQIGRFRKDKAMPALISGEKSTALVTP
FT                   PQWRNKAFNGLKDPERNYWAKEQITGSPEENIKAAITYLMMKLSNTKEESTIDQYDSTL
FT                   YSAIVQKGDLADNIRKERKTTIPNLTKNNPGKNLDKIHPGDILYYQKASMKVIITGWKP
FT                   ITIKNVAMNYNGGGDPKYAIKLQFVYTLLTKNRVL"
     atgctctgga ctgaaaacga tgcggaaaat acttctcagt ggaatggtta tccattacaa        60
     attggtcgtt ttcggaaaga taaagcgatg ccagctttaa tctctggaga aaaatctaca       120
     gcccttgtta ccccaccaca atggagaaac aaagcattca atgggttaaa agatccagaa       180
     agaaattact gggcaaaaga acaaataact ggctctccag aagagaatat caaagcagca       240
     attacttact taatgatgaa actttctaat acaaaggaag aatcaactat cgatcaatat       300
     gactcaactc tatatagcgc cattgtccaa aaaggcgatt tggctgacaa catcagaaaa       360
     gagagaaaaa cgaccatacc taacttaacg aaaaacaatc ctggaaaaaa tctcgataaa       420
     atacacccgg gagatatttt atattatcaa aaagcatcca tgaaagtaat aattactgga       480
     tggaaaccta tcacaataaa aaatgtagcg atgaattata atggtggtgg cgatcccaag       540
     tatgcaataa aacttcagtt cgtttataca ttactcacaa aaaacagagt attatga          597
//

If you have problems or comments...

PBIL Back to PBIL home page