(data stored in ACNUC7421 zone)

EMBL: BA000007.PE213

BA000007.PE213       Location/Qualifiers
FT   CDS_pept        complement(243534..244013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0216"
FT                   /product="type VI secretion system effector Hcp1 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33639"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33639"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7X3"
FT                   /protein_id="BAB33639.1"
FT                   /translation="MANLIYLTLNGDNQGLISSGCSSQPSIGNKAQTAHIDQIMIYEFM
FT                   HGLNRDQNVNHHHLTIKKPIDKASPLLGKAICDNELLTCDFSFYRTNKFGINELFYKIK
FT                   LTGAKISDIHVSISHIVVDNSVQPEESVSFSYESIIWEHCSAGTSAYSLWEDRLF"
     atggcgaatt taatttattt aacactaaat ggtgataatc aagggctcat ttcaagtggt        60
     tgttcatcac aaccatccat tggaaataaa gctcaaacag cacacattga tcaaattatg       120
     atttatgaat tcatgcatgg attaaatcga gatcaaaacg tcaaccatca tcatttgaca       180
     ataaaaaaac ctatagataa agcatcaccc ttattaggca aagcaatttg cgacaatgaa       240
     ttattgacat gtgatttttc cttttatcgt acaaataaat ttggaattaa tgaactgttc       300
     tataaaatca aattaactgg agcaaagata agcgacattc atgtctctat atcacatatt       360
     gttgttgata acagcgttca acccgaagag tcagtttctt tcagttatga gtcaattata       420
     tgggagcatt gttccgctgg cactagtgca tacagtttat gggaagatcg tcttttttaa       480
//

If you have problems or comments...

PBIL Back to PBIL home page